KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A3201Help
Entry
LIF_A3201         CDS       T01983                                 

Definition
cholesterol oxidase
Organism
lie  Leptospira interrogans serovar Lai IPAV
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(4005617..4007341)
Genome map
AA seq 574 aa AA seqDB search
MKKYEAVVIGTGFGGAVNGCRLSKKWPGKVLILERGKRYPKGSFPRSPHDMSKNFWNVPE
ENSSKVRPKKLSKLNQTGLFDIRNYKNMDVVISAGLGGGSLIYANVFLEPPDHIFDERWP
ANIKKKSLTPYYKIVKDVLGSRPIPLNDDPRRKIVRTTLYQKFAKHTGRESKLADINVFF
GNDFKKPTPIGLQEKNRYGAVQTSCTYCAECDIGCNTHSKNTLDLNYLFVAENKYKAEVR
TEQLVQKIVPLGPDGNDNSSYHGENGYRVYFRNFSDQKRELISVITKRVIVSAGTLGSTE
LLLKCKEEFKTLPDISDHLGKQFSGNGDFLSFAIKGKEPANPNYGPVITQYTDYNLFKSY
NPKRAFILQDASYPVFASYFAAASVPWFLRIGFFFHTFVELFKKFLNGKIFGKIGYLMGE
LLKGDLSYTSAVLLCMGIDRADGTMVLDRKKNLQIQWPQKNNMSLYEAILSVMKDFASFI
KTDFYFPLPTWSWPIRNNVSVHPLGGCIIGNSKTNSVTSADFKTFGQVFSYQGLYVADGS
LSPTAIGANPSMTIAALSEKVAEGITGIKPTANL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacgaagcggttgtaattggtactggatttggcggagccgtgaacggttgt
agattgagtaaaaaatggccgggtaaagttttgattttagaacgtggaaaacgttatccc
aagggctctttccctcgttcccctcacgatatgtccaagaatttttggaatgttccagag
gagaacagttccaaagttcgtcctaaaaaactttcgaaactaaatcagacgggtttgttt
gacattcgaaattacaaaaatatggatgtggttatttctgccggacttggcggagggtcc
ttgatttatgcgaacgtatttttagaacctccggatcatatctttgatgagcgttggcct
gcgaacataaaaaagaaaagtttaacaccgtattataaaattgtaaaagacgttttgggc
tccaggccaattcctttaaacgatgatcctcgtagaaaaattgttcgaacaactctttac
caaaagtttgcaaaacacactggcagagaatctaaattggcggacataaacgtatttttc
ggaaacgattttaaaaaaccaactccaataggacttcaagaaaaaaatagatacggagct
gttcagacttcttgtacgtattgcgcggaatgtgatataggatgtaatactcattctaaa
aatactttagatctaaattatctttttgttgcggagaataagtataaggcggaagtcaga
acggaacagctggttcaaaaaattgttcctcttgggccggatggaaatgataattcctct
tatcacggcgaaaacgggtatcgtgtttattttagaaatttttccgatcaaaaaagggag
cttatctccgtcattacaaaacgtgtaatagtttccgcgggaacattaggaagtactgaa
cttcttttaaaatgtaaggaagaatttaaaacacttccagacatttcggatcatctagga
aaacaattttcaggcaacggagattttttatcttttgcgatcaaaggaaaagaacctgct
aatccgaattacggtccggtgatcactcaatataccgattataatttatttaagagttat
aatcctaaaagggcttttatacttcaagatgctagttatccagtctttgcttcttatttt
gctgcggcttctgttccatggtttttaagaattggatttttctttcatacgttcgtggaa
ctttttaaaaaatttctaaatggaaaaattttcggaaagataggttatctgatgggcgaa
ctgttgaaaggtgacctttcttatacgtctgcggtgttgttgtgtatgggaatcgatcga
gcggatggtacaatggttttagaccgtaaaaagaatcttcagattcaatggcctcagaaa
aataacatgtctctttatgaagccattttaagtgtgatgaaggactttgcttcgtttatc
aaaactgatttttattttccacttcctacttggtcatggccgattcgaaataacgtttct
gtgcatccacttggtggttgtattattggaaattctaaaaccaattcggtaacgtctgca
gattttaaaacgtttggacaggttttttcgtatcaaggcctttacgttgcagatggaagt
ctttctcctactgcgattggggcaaatccttctatgactattgctgctctttctgaaaaa
gtcgctgagggaattacaggaatcaaaccgactgccaatctttag

DBGET integrated database retrieval system