KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A3341Help
Entry
LIF_A3341         CDS       T01983                                 

Gene name
glnS
Definition
bifunctional glutamate-tRNA ligase/glutamine-tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lie00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LIF_A3341 (glnS)
Enzymes [BR:lie01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LIF_A3341 (glnS)
Amino acid related enzymes [BR:lie01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LIF_A3341 (glnS)
Transfer RNA biogenesis [BR:lie03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LIF_A3341 (glnS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(4175263..4176828)
Genome map
AA seq 521 aa AA seqDB search
MNQSKEVRTRFAPSPSGFLHVGGARTALFNYLYAKSQGGKFILRIEDTDQNRSTEDSFKI
ILESLKWLGVNWDEGPEVGGEYGPYIQSQRLNIYKEYTEKLLKEKKAYRCFCTQEELEAK
KKQSEAMGVPYVYDGLHANMSDEEVQEKLKQGIPYSVRFKTPSKTLIINDIIQGKVKFET
KLIGDFIIVKSDGFPSYNYAVVVDDALMKITHVIRGVGHLSNTPRQILLYEALGYNIPEF
AHASEIVGMDGKKLSKRAGATSILAFRDLGYLPETFRNYMALLGWTSTDGREFLPGDELE
KIFDVHRCSKSPSTFDVFKKPKGSDEEVVTNFSDLTQIAEAMNPKSKLNWLSNRTIRDLN
ISKVLENLLPFLMDRKDIPAEVKNVNNPILTSIVESVRVYLDNLTQAPDYVAEFFVTDLK
IQSEETIGFLKDGEGPKVVNEFYEILKNSDPKTDEDYKNLMSKVGEVTGQKGKTLYMPIR
AATTGKSAGLELPILFPLLGKEKLLQRIEKTSKETGISLSN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaagtaaagaagttcgtacccgatttgcgccgtctcctagcggatttttacac
gtaggtggagcgcgaaccgctctttttaattatttatacgcaaagtctcaaggcggaaaa
ttcattttaagaatcgaagatacggatcaaaacagatccacggaagattcttttaaaatc
atattagaatctttgaaatggttgggagtaaattgggacgaaggtcctgaggttggagga
gaatatggtccctatattcaaagccaacgtttgaatatttataaagaatatactgaaaaa
cttctgaaggaaaaaaaggcttatcgttgtttttgcactcaagaagaattagaagccaaa
aaaaaacaatcggaagcgatgggagttccttatgtctatgatggacttcatgcgaatatg
tctgatgaggaagtgcaagaaaaactcaaacaagggattccatattcggttcgatttaaa
actccttctaaaactttgatcatcaatgacattattcaaggaaaagtaaaattcgaaaca
aagttgatcggcgattttattatcgttaagtcggatggatttccttcttacaattacgcg
gtcgtagtagacgacgcccttatgaaaatcacacatgtgatccgaggggtgggccatctt
tccaatactccgagacaaattttattatacgaagcactgggttataatattccagaattt
gcacatgcttctgaaatcgttggaatggatggaaaaaaactttctaaaagagcgggagct
acttcgattttagcgtttagggatttaggttatttaccagaaacgtttcgaaattatatg
gctcttctgggatggacttctacagacggaagagagtttcttcccggagatgaactcgaa
aaaatttttgacgttcatcgttgttctaaatctccttctacgtttgacgtatttaaaaag
ccgaaaggtagtgatgaagaagttgttacgaacttttcggatttgactcagattgcggag
gcgatgaatcctaaatccaaactcaattggttgtccaatcgaacgattcgggatttgaat
atatccaaagtattagagaatcttcttcccttcctgatggatagaaaagatattcctgcc
gaagttaaaaatgtaaacaacccaatccttacttctatcgtagaatctgtaagagtgtat
ttggataatctaacacaggctccggattatgttgcagaattttttgttactgacttaaag
atccagtctgaagaaaccatcgggtttttaaaggacggcgaaggtcccaaagttgtaaat
gaattttatgaaatattgaagaattccgatccaaaaaccgatgaagattataagaatcta
atgtctaaagtcggagaggtgaccggacaaaaaggaaaaactctttatatgccgattcgg
gcagctactaccggaaagtcggccggattggagttaccgattttatttccacttttgggg
aaagaaaagctactccaaagaattgaaaaaacttcaaaagaaaccggaatttcgttgtcg
aattga

DBGET integrated database retrieval system