KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A3388Help
Entry
LIF_A3388         CDS       T01983                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LIF_A3388
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LIF_A3388
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LIF_A3388
Enzymes [BR:lie01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LIF_A3388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:4236797..4238128
Genome map
AA seq 443 aa AA seqDB search
MKFQISKYKTIFYFFSLFFNHILNAESAKIVSGPILGYSTLKEVLVWVQTDQKSNVKLEY
SEIGNSKNKLFSEEIQTKSEQGFIAKLIANQVEPGKKYNYNILIDGKKIPAKHSQVFQTQ
PFFAYASNEDPPSFSFALGSCSYINEPEFEVPGKTYGGEYFIFNSILSKKPNFMLWLGDN
IYLREPDWDSRTGFFHRYRQQRGIPELAPLFASVHHYAIWDDHDFGPNDADSSYWMRETS
EEMFKLHWGNPNYAKEGIYGSFIWGDVQFFLLDNRTFRTANNNKMISPRQILGEKQFQWL
VNSLAYSKATFKFIAMGGQFLNPNPIFENYATYLEEKNKILSAIQDLKVKNIIFLTGDRH
FTELNFLKEKDISIYDLTVSPLTSKPYSPDSEKNPLRVEKTLVDKRNFGTISISGKRNER
KLVLQIFDVYGKELWKKEILSNP
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccaaatttcaaaatataagacaattttttattttttctctctattcttcaat
catatactcaacgcagaatcagcaaaaatcgtttcgggacctattttaggatattccact
ttaaaagaagtattggtttgggttcaaacagatcaaaagtctaacgttaaattagaatat
tctgaaattggaaattcaaaaaataaacttttttccgaagaaattcaaacaaagtcagag
cagggttttattgcaaaattgattgcaaatcaagttgaaccaggtaaaaaatataattat
aatatacttatagatggaaaaaaaattccagcaaaacattcgcaagtatttcaaacccaa
ccttttttcgcctatgcctctaatgaagaccctccctctttctcctttgcccttggaagt
tgttcttatataaacgaaccagaatttgaggttccaggaaaaacttatggaggagaatat
tttatttttaattcaattctttctaaaaaacccaattttatgctttggttaggggacaac
atttatttgagagaaccagattgggattcaagaactgggttttttcatcgttacagacaa
caaaggggaattccagaacttgccccactttttgcatcggttcatcattacgcaatttgg
gatgaccacgattttggtccaaacgatgcagactcttcttattggatgagagaaacttcc
gaagaaatgttcaaactccactggggaaatccaaattatgcaaaagaaggtatttacggt
tcttttatatggggtgacgttcaattttttcttttagacaataggacatttagaacagct
aacaacaataagatgataagcccgagacaaattttaggtgaaaaacaatttcagtggctc
gtaaattcactggcttattcaaaagctacttttaagtttatagctatgggaggacaattt
ttaaatccgaatccaatttttgaaaattacgcaacttatctagaagaaaaaaataaaata
ctttccgcaattcaagatttaaaagttaaaaatataattttcttaacgggtgaccgccat
tttacagaattgaattttctaaaagaaaaagatatatctatctacgatcttacagtttct
cctctaacatccaagccttattctccagattcggaaaagaatcctttgcgtgtggaaaaa
actctcgttgataaaaggaatttcggaaccatttccataagtggaaaacggaatgaaaga
aaactagttctacagatttttgacgtttatggaaaagaactttggaaaaaagaaatcctt
tcaaatccttga

DBGET integrated database retrieval system