KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A3396Help
Entry
LIF_A3396         CDS       T01983                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LIF_A3396 (folE)
Enzymes [BR:lie01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     LIF_A3396 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(4248727..4249278)
Genome map
AA seq 183 aa AA seqDB search
MEEDVINILKSIGEDPTREGLLNTPKRVKKAYEFLTSGYRADITKIVNGAIFEEPTEGMV
LVRDIEMYSLCEHHLLPFYGKAHVAYLPNKKIIGISKIPRIVDVFARRLQVQERLTEQIA
YAIQEVLDPQGVAVVIKAKHLCMMMRGVEKQNSELFTSCMLGAFKENMVTRSEFLDLIRT
GST
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaagatgtaattaatattttaaaatcgattggagaagatccaactagagaaggc
cttctcaatactccaaaacgagttaaaaaggcgtacgaatttttgacatccggttatcgc
gctgacattacaaaaattgtaaatggagccatctttgaagaaccaacagaaggaatggtt
ttagttagagatatagaaatgtattccctttgtgaacatcaccttcttcctttttatgga
aaggcgcatgtagcttatctcccaaacaaaaagatcatagggattagtaaaattcctaga
attgtggatgtttttgccagaaggttgcaagttcaagaacgtctcacagaacagattgct
tacgctattcaagaagttttagatcctcaaggtgttgccgtggtaatcaaggcaaaacat
ctttgtatgatgatgagaggggtggaaaaacaaaattctgaacttttcacctcgtgtatg
ttaggtgcttttaaagaaaacatggtcactcgttctgaatttttggatctgattcgtact
ggatccacttaa

DBGET integrated database retrieval system