KEGG   Leptospira interrogans serovar Lai IPAV: LIF_A3462Help
Entry
LIF_A3462         CDS       T01983                                 

Gene name
recR
Definition
recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lie00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LIF_A3462 (recR)
DNA repair and recombination proteins [BR:lie03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LIF_A3462 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:4323358..4323963
Genome map
AA seq 201 aa AA seqDB search
MAENLANHLLDEMIEALSSLPGIGRKSAFRISFHLLRLEQGLFNQFIHQLTDTKNKIKFC
KRCGSYAETEICEICVSEKRDSHTFCVVEQPEDIFFIENTREFQGKYHVLNGVISPLEGI
GPRDLRIKELLERIEPEQVKEVLIATNPTLEGDATADYLANQLKPISVNVTRIAYGITVG
GSIELADQYTLGRAIRSRLQL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttggcggaaaatttggctaatcatcttcttgatgaaatgatagaagctctttcttctctt
ccaggaattggaagaaaaagcgcttttagaattagttttcatcttttaagattagaacaa
ggtctttttaaccaattcattcatcaacttacagatacaaaaaataaaatcaaattttgc
aaacgttgcggctcttatgcagaaactgaaatttgcgagatctgtgtttccgaaaaaaga
gattctcatactttttgcgtagtagagcaaccggaagacattttttttattgaaaacaca
agagaatttcagggcaaataccacgtgttaaacggagtcatttctcccttagaagggatc
ggtcccagagatcttagaatcaaagaacttttggaaagaatagaaccagaacaagtaaaa
gaagttttgatcgctactaacccgaccttagaaggagacgcaacagccgattatttagca
aatcaattaaaacctatttcggttaatgtaactagaatcgcttatgggattacggtcggt
ggttcgatcgagcttgctgatcaatatactttaggaagagcaattcgttctcgtcttcaa
ctttag

DBGET integrated database retrieval system