KEGG   Leptospira interrogans serovar Lai IPAV: LIF_B007Help
Entry
LIF_B007          CDS       T01983                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LIF_B007 (hemB)
Enzymes [BR:lie01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LIF_B007 (hemB)
Exosome [BR:lie04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LIF_B007 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:8860..9813
Genome map
AA seq 317 aa AA seqDB search
METKQRRIRLNAGLRNLASSESLNSKKLIQPIFIVEGLKEKEKMDSLPGVFRDTESSVFK
QVESDLKAGVTHFILFFIPELKSNSEIPKSFYERSISSLKKKFPESFLWIDTCMCSLTTH
GHCGLLHPDGSIDNHTSVKHLSDIALVYAQSGADGIAPSDMMDGRIKSHRSILDVNGFSN
IPILSYSTKFKSNFYGPFRAAADSAPAQGDRSSYQIDVRNREDAVLSSIRDKEEGADFLM
VKPGMTSIDLIGPIREKTGLPTGVYQVSGEYASIHYLSQNGFCDFDSALSETWQIFSRAG
ASYLITYAARRGKEILS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaccaaacagagaagaattcgccttaacgctggacttagaaatcttgcgtcttcg
gaaagtttaaattcaaaaaaactaatacagcctatttttatcgtagagggtttaaaagaa
aaagaaaaaatggattctcttcctggggtttttagagatacggagtcttctgtttttaag
caggtagaatcggatctcaaggcaggagtgactcattttatacttttttttattccggaa
cttaaatccaattcggagattcctaaatccttttatgaacgttccatttcttctttaaag
aagaaatttccagaatcctttttatggatagatacttgtatgtgttctcttaccactcac
ggtcactgcgggcttttgcatccggatggaagtatcgataaccacacttctgtaaaacat
ctttcggatattgctttggtttacgcgcaatccggtgccgatgggattgcgccaagcgat
atgatggacggaagaattaaaagccaccgttcaattttagatgtaaacggattttcgaat
attccaattttaagttattctactaaatttaaaagtaacttttatgggccgtttcgtgcg
gctgccgattctgctccggctcaaggggatcgttcttcgtaccaaatagacgttcgaaat
cgggaggacgctgttctttcttctatacgtgataaagaagaaggtgcggactttctgatg
gttaaaccaggaatgacttccattgatcttattggtccgatccgtgaaaaaacgggactc
cccacgggagtttatcaagttagtggagaatacgcttcgatccattatctttcacaaaac
ggtttttgtgactttgattctgcgttatccgaaacttggcagattttttccagagcaggg
gcttcttatctaattacgtatgccgccagaagaggtaaggagattttatcttga

DBGET integrated database retrieval system