KEGG   Leptospira interrogans serovar Lai IPAV: LIF_B014Help
Entry
LIF_B014          CDS       T01983                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LIF_B014
Enzymes [BR:lie01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LIF_B014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:16380..17663
Genome map
AA seq 427 aa AA seqDB search
MRTQSPDYIVIGAGFTGLLYSTLAVLEGRSVFLYEKQNRSGGLVGSIQTPFGLVETAANG
ILNSYQLEELASALGLNILTTEKKSKKRFIWKNGSPRRFPLSFLDTLRVLYGILGISAEI
RAGESVYQWGVRVLGKGAVKNVLEPGLGGIYAGNLKDMSAELALGSWISSKGSLLKNIRE
IKKIKTKNPKQKKGTVSFRGGLGELLNAMEAKIKSSPNSKIYYSQESPTLSSIRKKYPNS
KIILSCGLESSLKLLSSGFPVFKKYEKLCKTLGVVTVTRFGNQPLLGKKSGFGILFPSDS
GFRALGVLLNSSIFSGRVSKGHYSETFIFGGALDQEIVKFKEKEIINVLEEDRKKITVQN
DEPLNHYVTIWKSALPIYDLALLEFNKELDRSLPEGIFVEGNFRYGIGLSSILERAWNVM
RNQKGRT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacacaatcaccggattatatagtcatcggagcgggttttaccgggcttctttat
tctactcttgccgttttagaggggaggtctgtgtttctttacgaaaaacagaatcgatct
ggaggattggtagggtccatccaaacaccttttggacttgtagaaactgcggcaaatgga
atcctaaattcgtatcaactcgaggaacttgcttccgcgcttggtctgaacattcttacc
acagaaaaaaaatcaaaaaaaagatttatctggaaaaacggatctcctagaagattccca
ctctcttttttagacaccttacgtgtgttatatggaattttaggaatttccgccgagatt
cgagcgggagaatccgtttatcagtggggagttcgtgttttggggaaaggtgcggtaaaa
aacgtattggagcctggccttggcggaatttacgccggaaatttaaaggatatgtccgcc
gaactcgcgttaggaagttggattagttccaagggttcccttctaaagaatatccgtgaa
attaaaaaaataaaaacaaaaaatccaaaacaaaaaaaaggaacggtgagttttaggggt
ggtttaggagaacttctaaacgcaatggaagcgaaaattaaatcgtctccaaattctaag
atatattattcgcaagaatcccctactctaagctcgattagaaagaaataccctaattca
aaaattattctttcctgtggtttagaatcttctttaaaattattatcatcaggttttcca
gttttcaaaaaatatgaaaagttatgtaaaaccctaggagttgtaaccgtcactcgattt
ggtaaccaacctttgctcggaaaaaagagcggatttggaattctttttccttctgattct
ggttttagagctctaggagttttactcaactcttctattttttcgggaagagtttctaaa
ggacattactcggaaacttttatctttggaggagccctagaccaagaaatcgtaaaattt
aaagaaaaggaaattataaacgtattagaagaggatcgaaaaaaaataaccgttcaaaat
gacgagccactcaatcactacgttacgatttggaaatcagctcttccaatatacgattta
gctcttcttgaatttaacaaagaattagatcgaagtttgccggaaggaatttttgtagaa
ggaaattttagatatggcatcggcctcagttccattttagaaagagcctggaacgttatg
cggaatcaaaaaggacgtacataa

DBGET integrated database retrieval system