KEGG   Leptospira interrogans serovar Lai IPAV: LIF_B090Help
Entry
LIF_B090          CDS       T01983                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:lie01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lie01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lie00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lie00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lie00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lie00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:lie00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:103023..104318
Genome map
AA seq 431 aa AA seqDB search
METKIQNFGECSIPSPADYEYYTSDTSRLIFRTVFQSKEDWNSYVQEGPDFFEQAGPREK
IYFNPQEVTAGIVTCGGLCPGINDVIRGIVMELYYRYGVSRILGFPYGYQGLVKRYSHQP
IELTPEKVAHIVDEGGSMLSSSRGNQSPEEMVDSLSFYGVKILFCIGGDGTLRGARTIVD
EIAKRKEKISVVGIPKTIDNDINYVQKTFGFSTAFSKAMEAVECAHVEAKGAPNGIGLVK
LMGRHSGFIAVNAALASRNVNYCLIPEVDFDLFGNEAFLDDLKKRIQKKGHAVIIVAEGA
GQKFFDSTEERDSSGNLKLKDIGLFLKDTMTEFFKKENIPVNIKYIDPSYIIRSIPANAE
DSVFCGFLAQNAVHAGMAGKTDMVVGMWNNVFTHLPISVAIQERKVLQPDRSTLWRSLLA
STGQPAHMLAK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaaattcaaaattttggagaatgttcgatccctagtccggcggactatgaa
tattatacaagtgatacttctagattgatattcagaacggtatttcaatctaaagaggat
tggaattcttatgtccaagaaggtcctgattttttcgaacaggctggtcctagagaaaag
atttattttaatcctcaagaagtaactgcagggattgttacatgtggggggctttgccct
ggaatcaacgacgtgattcgtggaatcgtaatggaactttactatcgttacggagtttcc
agaattttaggttttccttatgggtatcaaggtcttgtaaagagatactctcatcagcca
attgaactcactccagaaaaagtagcgcatatcgtagatgaaggcggatctatgttatct
tcttcgagaggaaatcaatctcccgaagaaatggtggatagtcttagtttttatggagtg
aaaatacttttttgtattggaggagatggaactctcagaggggctagaacaatcgtggat
gaaattgcaaaaaggaaagaaaaaatttccgtagtaggaattccaaaaacgattgataac
gacatcaactacgtacaaaaaacattcggtttttctactgcgttttccaaagcaatggaa
gcggtagagtgcgctcatgtggaagcaaagggagcgccgaatggaattgggcttgtaaag
ttgatggggcgtcattccggatttattgcggtcaacgcggctttggcttctagaaatgta
aattattgtctaattccagaagtggactttgatctatttggaaacgaggcctttttagac
gatctcaaaaaaagaatccaaaaaaaaggacacgctgttatcattgtagcagaaggagct
ggtcaaaaattttttgattctacggaagaaagagattcttccggaaatttaaaactcaaa
gacattggactttttctaaaagatacgatgactgagttttttaaaaaggaaaatattccg
gtaaacatcaaatatatcgatcctagttatattattcgatcaattccggctaacgcagaa
gattctgtattttgtggttttctggctcaaaatgctgtacacgccggtatggcgggaaaa
acggatatggtggtgggaatgtggaataacgtgtttacacatcttccgatttcagttgca
attcaggaaagaaaagttctacagccagatcgaagcactctttggagatcacttttggct
tctacggggcagccggctcacatgttggcgaaatag

DBGET integrated database retrieval system