KEGG   Leptospira interrogans serovar Lai IPAV: LIF_B090Help
Entry
LIF_B090          CDS       T01983                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
lie00010  Glycolysis / Gluconeogenesis
lie00030  Pentose phosphate pathway
lie00051  Fructose and mannose metabolism
lie00052  Galactose metabolism
lie00680  Methane metabolism
lie01100  Metabolic pathways
lie01110  Biosynthesis of secondary metabolites
lie01120  Microbial metabolism in diverse environments
lie01130  Biosynthesis of antibiotics
lie01200  Carbon metabolism
lie01230  Biosynthesis of amino acids
lie03018  RNA degradation
Module
lie_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIF_B090 (pfkA)
   00030 Pentose phosphate pathway
    LIF_B090 (pfkA)
   00051 Fructose and mannose metabolism
    LIF_B090 (pfkA)
   00052 Galactose metabolism
    LIF_B090 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LIF_B090 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LIF_B090 (pfkA)
Enzymes [BR:lie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LIF_B090 (pfkA)
Protein phosphatases and associated proteins [BR:lie01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LIF_B090 (pfkA)
Messenger RNA biogenesis [BR:lie03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LIF_B090 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AER04333
Position
2:103023..104318
Genome map
AA seq 431 aa AA seqDB search
METKIQNFGECSIPSPADYEYYTSDTSRLIFRTVFQSKEDWNSYVQEGPDFFEQAGPREK
IYFNPQEVTAGIVTCGGLCPGINDVIRGIVMELYYRYGVSRILGFPYGYQGLVKRYSHQP
IELTPEKVAHIVDEGGSMLSSSRGNQSPEEMVDSLSFYGVKILFCIGGDGTLRGARTIVD
EIAKRKEKISVVGIPKTIDNDINYVQKTFGFSTAFSKAMEAVECAHVEAKGAPNGIGLVK
LMGRHSGFIAVNAALASRNVNYCLIPEVDFDLFGNEAFLDDLKKRIQKKGHAVIIVAEGA
GQKFFDSTEERDSSGNLKLKDIGLFLKDTMTEFFKKENIPVNIKYIDPSYIIRSIPANAE
DSVFCGFLAQNAVHAGMAGKTDMVVGMWNNVFTHLPISVAIQERKVLQPDRSTLWRSLLA
STGQPAHMLAK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaaattcaaaattttggagaatgttcgatccctagtccggcggactatgaa
tattatacaagtgatacttctagattgatattcagaacggtatttcaatctaaagaggat
tggaattcttatgtccaagaaggtcctgattttttcgaacaggctggtcctagagaaaag
atttattttaatcctcaagaagtaactgcagggattgttacatgtggggggctttgccct
ggaatcaacgacgtgattcgtggaatcgtaatggaactttactatcgttacggagtttcc
agaattttaggttttccttatgggtatcaaggtcttgtaaagagatactctcatcagcca
attgaactcactccagaaaaagtagcgcatatcgtagatgaaggcggatctatgttatct
tcttcgagaggaaatcaatctcccgaagaaatggtggatagtcttagtttttatggagtg
aaaatacttttttgtattggaggagatggaactctcagaggggctagaacaatcgtggat
gaaattgcaaaaaggaaagaaaaaatttccgtagtaggaattccaaaaacgattgataac
gacatcaactacgtacaaaaaacattcggtttttctactgcgttttccaaagcaatggaa
gcggtagagtgcgctcatgtggaagcaaagggagcgccgaatggaattgggcttgtaaag
ttgatggggcgtcattccggatttattgcggtcaacgcggctttggcttctagaaatgta
aattattgtctaattccagaagtggactttgatctatttggaaacgaggcctttttagac
gatctcaaaaaaagaatccaaaaaaaaggacacgctgttatcattgtagcagaaggagct
ggtcaaaaattttttgattctacggaagaaagagattcttccggaaatttaaaactcaaa
gacattggactttttctaaaagatacgatgactgagttttttaaaaaggaaaatattccg
gtaaacatcaaatatatcgatcctagttatattattcgatcaattccggctaacgcagaa
gattctgtattttgtggttttctggctcaaaatgctgtacacgccggtatggcgggaaaa
acggatatggtggtgggaatgtggaataacgtgtttacacatcttccgatttcagttgca
attcaggaaagaaaagttctacagccagatcgaagcactctttggagatcacttttggct
tctacggggcagccggctcacatgttggcgaaatag

DBGET integrated database retrieval system