KEGG   Leptospira interrogans serovar Lai IPAV: LIF_B206Help
Entry
LIF_B206          CDS       T01983                                 

Definition
UTP-glucose-1-phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lie  Leptospira interrogans serovar Lai IPAV
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lie00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LIF_B206
   00052 Galactose metabolism
    LIF_B206
   00500 Starch and sucrose metabolism
    LIF_B206
   00520 Amino sugar and nucleotide sugar metabolism
    LIF_B206
Enzymes [BR:lie01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LIF_B206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(259249..260622)
Genome map
AA seq 457 aa AA seqDB search
MTSEGLSSAFIQDFLKKTDLVRNGETGMVRWEEVGDLDPKADEITLEQIESENAPEPSIL
KNLVVIKLNGGLGTSMGLSGPKSLIELKNGMSFLEIVAKQSEVIEKKYNVSVPLILMDSF
NTQKESQEELNRIGFRQKFPTSFLQHKVPRLLKKDLTPISCKNPDEEWCPPGHGDIWISL
LETGLLDTLIQNGYKIAFVSNGDNLGATVHPGILSYMLKEKLEFCMEMTPKTLADKKGGA
IYKRMVAGRAENYQLLETAQVPPEHMHEFEGLGKFRTFSTNNLWIDLVALRQRILLGSFE
LSLIVNPKTIEGQEVLQLETAMGSAIRNFEKVKGIIIPRDRFAPVKKCEDYLARRSDAYH
LLENYSITMSDKRKESGLGEILIYLDERYYKKIGDFNRLFPEIPSLELCSSLTVQGEVLF
DQKISIVGEVVIQNNETLPRRISDLKTRILESGKYSF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgaaggtttatcttctgcttttatccaagactttttgaaaaaaaccgatctg
gttcgaaacggagaaaccggaatggttcgctgggaagaagtaggagatctagatcctaaa
gcggacgagattactttagaacaaattgaaagtgagaatgctcccgagccttcgattctt
aaaaacttagtcgttatcaaactcaatggtggacttggaacttctatgggactctccggt
cctaaatctttaattgaactcaaaaatggaatgtcctttttagaaatcgttgcgaaacaa
tctgaggtcattgaaaaaaaatataatgtgtctgttcctttgattctaatggacagtttt
aatacacaaaaggaaagtcaagaggagttgaatcggatcggattccgtcaaaaatttccc
acttcttttttacaacataaagtgcctcgtcttttgaaaaaggacctaacacctattagc
tgcaagaatccggatgaagaatggtgtcctcccggtcacggtgatatatggatttctctt
ttggaaactgggcttttagacactctcattcaaaacggatacaaaattgcttttgtatcc
aacggagacaacttaggagctacggtacatccaggaattctttcctatatgttgaaagag
aaactggaattttgtatggagatgactcctaaaactcttgcggataaaaagggcggagcg
atctacaaaagaatggttgccggaagagcggagaattatcaactcctcgaaacggctcag
gttccacccgaacacatgcacgaatttgaaggtttaggtaagttcaggactttttcaaca
aacaatctttggatcgatttggttgcccttcgacaaagaattcttctcggaagttttgaa
ctttctctgattgtaaatccaaaaacgatcgaaggacaagaagttctacagctcgaaact
gcgatgggttccgcgatccgaaattttgaaaaggtcaaagggatcatcattcctagagat
agatttgctcctgtaaaaaagtgcgaggattacctcgctcgtagatcggatgcgtatcac
cttttagaaaactattctattaccatgtccgacaaaagaaaagaatccgggttaggcgaa
atactgatttatctggatgaaagatattacaaaaagattggagactttaatcgacttttt
ccagaaattccttctttagaactttgttcttctcttaccgttcaaggagaagttctattc
gatcaaaaaatttccatcgtgggagaggttgtaattcaaaataacgaaacactacctcgg
agaatatcagatttaaaaactagaattttagaatctggaaaatattccttttaa

DBGET integrated database retrieval system