KEGG   Leishmania infantum: LINJ_05_0830Help
Entry
LINJ_05_0830      CDS       T01112                                 

Definition
putative methylthioadenosine phosphorylase
Orthology
K00772  
5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
lif  Leishmania infantum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LINJ_05_0830
Enzymes [BR:lif01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.28  S-methyl-5'-thioadenosine phosphorylase
     LINJ_05_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:301359..302279
Genome map
AA seq 306 aa AA seqDB search
MYGNPHKEPVAIAVIGGSGIYKLDCLQDAKYYDVPTPYGNPSGQLCVAKVDGVPCVFLPR
HGPHHQYNPSEINYRANICALKQMGVRYILAINAVGSLDESCKPGDLVLCDQIIDKTYAR
KATFFEGGVVAHADFAHPTSRIFNNIAHEALLRCFPDVAAGKGTFQIHSSGTLVTMEGPQ
FSTKAESLLNKQMGGHLIGMTSATEARLAREAEIAYATVAMVTDMDAWSDAPHVDAAQVT
KVMAANVEKAQRYPSEIIKSLAQNLFDDPAHHTLEYAIVTKPEHIPAETKQRIAPLVASK
YPQFAP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtacggtaatccgcacaaggagcccgtcgcgatcgccgtcatcggcggctctggcatc
tacaagctggactgcttgcaggatgcaaagtactacgacgtaccgaccccgtatggcaac
ccgagcgggcagctgtgcgtggccaaggtcgacggtgtgccgtgcgtcttcctgccgcgt
cacggtccgcaccaccagtacaaccccagcgagatcaactaccgcgccaacatctgcgcg
ctgaagcagatgggcgtgcgctacatcctcgccatcaacgctgttggatcgctggacgag
tcctgcaagcccggcgacctcgtgctgtgcgaccagatcatcgacaagacgtacgcgcgc
aaggcaaccttcttcgagggcggcgtcgtcgcgcacgcggacttcgcccacccgacgtcg
cgcatcttcaacaacatcgcgcatgaggcgctgctgcgctgctttccggacgtggcggcc
ggcaagggcacgttccagattcacagcagcggcaccctcgtgacgatggaaggtccgcag
ttcagcactaaggccgagtccctcctcaacaagcagatgggcggccacctgatcggtatg
acgtcggcaacggaggcgcgtctggcgcgtgaggcggagatcgcatacgcgacagtggcg
atggtgaccgacatggacgcgtggagcgacgcgccgcacgtggacgcggcgcaggtgacg
aaggtgatggcggcgaatgtggagaaggcgcagcgctacccgtccgagatcatcaagtcc
ctcgcccagaatctcttcgatgatccggcgcaccacaccctggagtacgccatcgtgaca
aagccggagcacatccccgccgagacgaagcagcgcatcgcgccgctcgtggcgagcaag
tacccgcagttcgccccgtag

DBGET integrated database retrieval system