KEGG   Leishmania infantum: LINJ_07_0820Help
Entry
LINJ_07_0820      CDS       T01112                                 

Definition
malonyl-coa decarboxylase-like protein (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
lif  Leishmania infantum
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LINJ_07_0820
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LINJ_07_0820
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    LINJ_07_0820
Enzymes [BR:lif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     LINJ_07_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:337030..339417
Genome map
AA seq 795 aa AA seqDB search
MRCVYRPASGASGCCRATASGGTTLSAGTVAYASRHFSAPTRLSRSEPPPPPLPPLPGPG
ATVSEERVARWCRRLWDLTRKSTGSVASAHVTPQLQLAAHRATAALLSSSSASPFTAPLQ
IDDNGEVTGEVVLSCLRRAIRSDQGRIPGVIVESVWAAFDVLVPPIVQNSVTEDSITPAT
EDSFFMFISTLNELNFDLHAVVKASTQLTAKVDSYVALLRQAEAQETQQAATAAACGSAQ
AAIDGCELMEKLMKTKGEVMQCCFEARNAGSPLYYTWLWHTAAMPDGLRRLMHFRKLTHF
FESLCKRHIKHLMQQQQQQPQRRSLLSSSAPATGESAGTLPSAAASSATEQSRCAGELSK
WRSRLVEVGLIDGAMSLLLHDLFSKEYLVMEELTWLSTPPSMLDQIMRAESVHPFVRGLE
DMRHRLQPAHHRHLFAFLHPAVVEEPLIAVQVALTHGIASSVDQILGRPTPLSDPANTSK
AALYFRHALESSAAVDCAGAAEDGNVNTAIFYSINSAQSALRGMDMGNRLIKRVVQEVEG
NINARRQARSLTPIHTFSTLSPIPLYVKWLADKVAALAAAAATATTMTASGIFGKQLSAT
EEDTRYLEPLRAAIAGYVLRHPGALPAEARAVMSAAAASSHGNHAAANIAALQYLVRLLQ
DSSSPPSLPRDDPAMFAAGSTSTERHQQPWWMDHAFTMALEAPLLHSVATYLCTAKRSGD
GRIRDPVGNFHVSNGATVYRLNFLANTTPKASCESACIMVNYWYDLPTVSANAAQYEVSR
TVPLGEPIKTLLGDI
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgtgtttatcggcctgccagcggcgcgagtggctgctgcagagccactgctagc
ggcggcactaccctttccgccggcaccgtggcgtacgcctcgcggcacttcagtgcgcct
acgcgtctgtcgcgatcggaaccaccgccaccgccactcccgccactcccggggccaggc
gccacggtgagcgaggaacgtgtcgcacgatggtgtcggcggctgtgggacctcacgcgc
aagtccactggcagcgtggcctctgcccatgtcaccccacagcttcaactcgccgcccac
agagcaacagcagcactgttatcatcgtcgtcggcgtcccccttcaccgcgccactgcag
attgacgacaatggggaggtgacgggcgaggtggtgctgtcctgcctgcgccgcgccatc
cgtagcgatcaaggccgcattcctggcgtcattgtggagagcgtgtgggccgccttcgac
gtgctcgtgccgcccatcgtccagaacagcgtcacagaggatagcatcacacccgcgacg
gaggatagcttctttatgttcatctcgaccttgaacgagctcaacttcgacctgcacgcg
gtcgtgaaggcaagcacgcagctgacagcgaaggtggactcctacgtggcccttctacgg
caggcggaggctcaagaaacgcagcaagcggcaacagcagctgcctgtggctctgcacag
gccgctatcgacggatgcgagctcatggagaagctcatgaagactaagggggaggtcatg
cagtgctgcttcgaggcccgcaacgccggctctcctctctactacacgtggttgtggcac
acggccgccatgccggacggcctgcggcggctcatgcattttcgaaagctgacccatttc
ttcgagagcttgtgcaagcgacacatcaaacatctcatgcagcagcagcagcagcagccg
cagcggcggagcttactgtcttcttcggcgcctgctactggcgagtctgcggggacgttg
ccatcagcagcagcatcaagcgccacggagcaaagtcgctgcgctggcgagctctccaag
tggcgtagtcgtctcgtcgaggtaggcctaatcgatggtgccatgtcgcttctcttgcac
gacctcttctccaaggagtacttggtgatggaggagctgacgtggctctcgacgccgccg
tcgatgctggaccagatcatgcgtgccgagtctgtccatccgttcgtccgcggactcgaa
gacatgcgccatcgcctgcaaccggctcaccaccgccacttgttcgcctttctgcacccc
gccgttgtcgaggagccgctcatcgccgtgcaggtggccttgacgcacggcatcgccagc
tctgtggaccagatcttgggtcgccctacgccgctgtcagacccggcgaacacgtcgaag
gcggccctctacttccgccacgcactggaatcctcggcggcggttgactgcgccggtgcg
gcggaagatggcaacgtgaacaccgccatcttctacagcatcaactctgcccagagtgcg
ttgcgtggcatggacatgggcaaccgcctcatcaagcgcgtcgtgcaggaggtggagggc
aacattaatgcccggcggcaggcgcgcagcttgactcccatccacaccttcagcaccctc
tcacccatcccactctacgtcaagtggctggctgataaggtggctgcgctggcggctgcc
gctgcgacagctaccacgatgacggcgagcggcatctttggcaagcagctctccgcaacc
gaggaagatacacgctacttggagccgcttcgcgcggcgattgccggctacgtcctgcgg
caccccggtgccctaccggcggaggcgcgtgcggtgatgtcagcggcggccgcaagcagt
cacggcaaccacgcggctgcaaacatagcggcactgcagtacctcgtgcgtctgctccaa
gactcatcttcgcccccctcgttgccgcgcgatgatcctgccatgttcgccgcgggcagc
acctcgacagagcggcatcagcagccatggtggatggaccatgcgttcacgatggccctc
gaggcgcccctgctgcactccgttgccacgtacctgtgcactgccaagcgtagtggtgat
ggccgcattcgcgacccagtcggcaactttcacgtgtctaatggcgccactgtttatcga
ctaaacttcctggcgaacacgaccccgaaggccagttgtgagagcgcctgcatcatggtg
aactactggtacgacctgccaacggtctcagccaacgctgcgcagtacgaggtgagccgc
accgtgcccctcggtgagccgatcaagacgctgctgggggacatttag

DBGET integrated database retrieval system