KEGG   Leishmania infantum: LINJ_09_0390Help
Entry
LINJ_09_0390      CDS       T01112                                 

Definition
putative cysteine peptidase, Clan CA, family C19
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LINJ_09_0390
Peptidases [BR:lif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LINJ_09_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:127790..130639
Genome map
AA seq 949 aa AA seqDB search
MRLRVLPRCRQTITSYLLSIMSATAASSRRKQHHESLKEESMISFEMELDEAIELPLDVS
AVAPTDAALSAPLGGKKITMPAARAASESRAAWSNGSTASLRFAVCGNGKELPNTPATAD
GVGSPIATPDNAATTTYSAAAPSRTLTWKDTSASQRRAEAQASRQDDFNPMVLCPLQNLG
NTCYFNAGVQLLVNCPALVYAVRNSPFAQSTQSNGPLTAHAVSMPRAEAATATTKLCLKG
GAATHTLFQEFSTLLARMEMGCAAGERAISPICALDSLAQAYPQFEGRSQQDAAEMMTSL
LASLEEEGGQYVEVAQLLQSFEEDAAALRQGVTSLASSPRASEPVARALKDATAPLLEAE
TAPSASPHRRDYSEPCNIEEYSQPSLLSSTSEDTFLPGPRSAHFFTVLRLMERVNRENEL
LERRVKQRQGIAYTNSFKPPRLHFNPLLDGFRGYTLSEVECHNCRAVSRVVSPFNGLLLD
VPTAKQRRRYALAHPNVPRRVDFDGQLRQVKKPFRLTWWNPLSLCVAAWRQLKRFFQDPF
PYPLWLDECLDIHFEPEVLRGCNRYRCESCDTTTDATKSETLLALPEYLLIHMKRFEAGR
FFNSKKSDSVFFPTSWRPLTKMQARQSPINTDDAPPALPEYLDLRHYLHSSVAPFAEPIP
PCLWSTGNEPHQQHHASRDDASSPASSIATTYTLDGIVNHHGGYDGGHYTVFLYKATEER
QAWVYISDDEVEQAEEVVATDTEYVLLYRRQPLVQAAPESDEAEQLRRKACYYLSQSSPS
CPAPNTAAATTAGPKSSKLHNRCPFSSSSAGGAASAPPHAATAATEPWVYISRMWLQRVV
FMHEPGPIVNRLCYCRPEDQGRVSMYRTIFPATVKVPAEVPHVHGPPVSWFYVPITQRDY
DIFYNAFGGNVAVTASEYESLRAMQGKFCAAIDLAERQRGSAARPAPRR
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgcgcgtgctgccacggtgtcgccaaaccatcacatcttacctgctgtccatc
atgtccgccacggcagcgtcgtcgcggcggaagcagcaccacgagtcgctcaaggaggag
tcgatgatctcgttcgagatggagctcgacgaggcgattgagctgccgctcgacgtgagc
gccgtcgcaccgacagacgcggcgctgagcgcgccgcttgggggtaaaaagatcacaatg
ccagctgcaagggccgcttcggagagcagggctgcatggagtaacggcagcaccgccagc
ctcagattcgccgtgtgcggcaacggaaaggagctcccaaacacccccgcaaccgccgac
ggcgtcggctctcccatcgccacgccagacaatgcagctaccacaacctactcggcggcg
gcgccgtcacgcacgttgacgtggaaggacaccagcgcgtctcagcggcgtgccgaggcg
caggcgagccgccaagacgacttcaaccccatggtcctgtgcccgctgcagaacctgggc
aacacgtgctacttcaacgcgggtgtgcagctgctcgtgaactgccccgccctcgtctat
gcagtgcgcaactcgccgtttgcgcagagtacacagagcaacggccccctcaccgcccac
gccgtatcgatgccgcgggctgaagcggcaacggcaacgacgaagctgtgcctgaaaggg
ggtgccgccacccacacgctcttccaggagttctccaccctgctcgcccgcatggaaatg
ggatgtgcagccggtgagagggcgatctcgcccatttgtgcgctcgactccctcgcgcag
gcgtatccgcagttcgagggtcgaagccagcaagacgccgcagagatgatgacgtcgctg
ctggccagcttggaggaggagggcggtcagtatgtggaagtggcacagctgctacagtcg
tttgaagaagatgccgcggcgctgcggcagggcgtgacgtccttggcctcctctccccgg
gcttcggagccagtggcgcgagctctaaaggacgccaccgcgcctctcttggaagccgag
accgcgccctccgcatcgccgcatcggcgcgattacagcgagccctgcaacatcgaggag
tactcccaaccatcgctgctctcctccactagtgaggacaccttcctgccgggtccgcgc
agcgcgcacttcttcaccgtactgcggctgatggaacgggtcaatcgcgagaacgaacta
cttgagcggcgtgtgaagcagcggcaaggcattgcctacaccaactccttcaagcccccg
cggctacacttcaacccgctgctggacggcttccgcgggtatacgctgtcggaggtggag
tgccacaactgccgcgcggtatcgcgcgtggtgagccccttcaatgggttgctgctggat
gtgccgacggcgaagcagcgccggcgctacgcgttggcgcacccgaatgtgccgcgccgc
gtcgacttcgatgggcagctgcggcaggtgaagaagccgtttcggctgacgtggtggaac
cccctctccctctgcgtggcggcgtggaggcagctgaagcggttcttccaggacccgttc
ccgtacccgctgtggctggacgagtgcctcgacattcacttcgagccggaggtgctgcgc
gggtgtaacaggtaccgttgcgagtcctgcgacaccaccaccgacgccaccaagtcggag
acgcttcttgccctgcccgagtacctgctcatccacatgaagcgcttcgaggccggccgc
ttctttaacagcaagaagtcggactcagtcttctttcccacctcgtggcggccgctcacg
aagatgcaggcgaggcagtcgcctatcaacacggacgacgcgccgccagcgctgccggag
tacctcgacctgcggcactacctgcacagcagcgtcgcaccgttcgcagagccgatcccg
ccctgtctgtggagcaccggcaacgagccccaccagcagcatcacgcgagcagggacgat
gccagcagccccgccagctccatcgcaaccacctacacgctagacggcattgtcaaccac
cacggcggctacgacggcggccattacactgtcttcctctacaaggcgacggaggagcgg
caggcgtgggtgtacatcagcgacgatgaggtggagcaagcggaggaagtagtggcgaca
gataccgagtacgtcctgctgtatcgccgccaacccctcgtgcaggcggcaccagagtcg
gacgaggcagaacagctgcgccgaaaggcgtgctactacctctctcagtcatccccctcc
tgccctgccccaaacaccgcggcagcgacgaccgccggccctaaatccagcaagcttcat
aacaggtgccccttctcgtcctcttcggcaggcggcgcggctagtgcgccacctcacgcg
gcaaccgcggcgaccgagccgtgggtgtacatctcgcgcatgtggcttcagcgcgtcgtc
ttcatgcacgagccgggcccgattgtgaatcgcctgtgttactgccgtccagaggatcag
gggcgggtgagcatgtatcggaccatctttccagccacggtgaaagtgccggcggaggtg
ccccacgttcacggcccgccggtgagctggttctacgtgcccatcacacagcgggactac
gacattttttacaacgcgtttggcggcaacgtagccgtgacggcgagcgaatacgagtca
ctgcgtgcaatgcagggcaagttctgcgccgccattgatttagcggagcggcagcgaggc
agcgcagctcgccctgctccccggcgctga

DBGET integrated database retrieval system