KEGG   Leishmania infantum: LINJ_09_1410Help
Entry
LINJ_09_1410      CDS       T01112                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
lif  Leishmania infantum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(514856..515191)
Genome map
AA seq 111 aa AA seqDB search
MASSRSAPRKASNPHKSHRKPKRTWNVYVGRSLKAINAQMSMSHRTMKIVNSYVNDVMER
ICTEAASIVRANKKRTLGAREVQTAVRIVLPAELAKHAMAEGTKAVSSASR
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctcgctctgctccccgcaaggcttccaacccgcacaagtcgcaccgtaag
cctaagcgcacgtggaacgtgtacgtgggccgctcgctgaaggcgatcaacgcccagatg
tcgatgtcgcaccgcacgatgaagatcgtgaactcgtacgtgaacgacgtgatggagcgc
atctgcactgaggccgcgtcgattgttcgcgcgaacaagaagcgcacgctgggtgcgcgc
gaggtgcagacggcggtgcgtattgtgctgccggcggagctcgcgaagcacgccatggct
gagggcacgaaggccgtgtcgagcgcgtcgcgttga

DBGET integrated database retrieval system