KEGG   Leishmania infantum: LINJ_14_0020Help
Entry
LINJ_14_0020      CDS       T01112                                 

Definition
putative phosphatidylinositol 3-kinase 2 (EC:2.7.1.137)
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
lif  Leishmania infantum
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LINJ_14_0020
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LINJ_14_0020
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     LINJ_14_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14:7627..10770
Genome map
AA seq 1047 aa AA seqDB search
MSLRVRLRVPKQWDRFQVNIDEELQQEELSRTLTEREIDDFNRRNLHSVSELSDHLRLLV
FGSDECVTCSEDICAAVEYIVGPQRRWNSSCDEVCEFRRAISRAYLNEWKAFQSVHPSVP
ERLATRSLPQVFSVPPLQKAQMDLLMQMCPRNAETGDGSISMRLWYLDSAGSRCSTRRRF
PFDTAADDAIRLTMSSAREFASMREKTDDTPLIFVFRVKGRNEYIYGSQPLINYRYIRHC
VSKRAEIDLVVEPKEATLFAVPLFRPSYPSRTLASPSDADASKSSTSEICLWDLTSKLSI
RIVGGFEKLAISASRMKDENVRDSSSLYFAVLVEAYVGTWRCCEPQITDWQLCENAKNSH
SLAARVYWKDGGTVTFSIDLSNVPRELKLCFTLVASSTDRIVGARAATAEEVIAAVEVNT
KKTDDQGHSVFFLGTAATQLFDYAAKMRMGMWRIYLWEGKTRANPIGLNSINPDSNACTF
EVEFPCFDKPVFFPSGRPPKRKEEDARRNFADREAALSSYLINNEVEQLRQLKRVLMYDP
LVHLSSDDKTILWKYREMLLGQPKAMAKVMSAVNWLMPFDVYEAHCLLRRWSPLAAFDAL
ELLDAHYADLAVREQAVEYIDKMSDYELRGCILQLVQVLKYEPYHYSALARFLLRRSLRS
NHIIGHYVFWYLAAEVKNLTICERHGLLLEELIKRSPHRLDYVRQVYVCNELLKCALRVQ
RAPKKDRVKCLRASLAKVRFPHRFTLALNPSVECCAVDIDECKVMESKKFPLWLAFRNHL
DQDEHFFIIFKSGDDLRQDLLTLQLLEFMDSLWKASGLDLHLIPYGCISTGEGVGMIEVV
LNSDTIANITRREGGAQAAFNVDPIINWLRQFNHDRGEVERCLWNFVLSVAGYTVATYVL
GIGDRHNDNIMLRQDGTLFHIDFGHFLGNFKTKFGIKRETAPFIFTPMYLYAMGGSSSPI
FKYFVDVACRAYNALRRHSSALMMLFMLMLSTGIPELQTLEDIEWLRTVLLLNRTDEEAS
DHYKGLINDALGNFRTLLNDYIHIMVH
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttacgtgtacgactacgggtgcccaagcagtgggataggtttcaggtgaacatc
gacgaggaacttcagcaagaagagctctcaaggactctgacagagagggagatcgatgat
ttcaaccgacggaacctccacagcgtctcggagctcagtgatcatttgcgcttgctcgtc
tttgggagtgatgagtgtgttacctgctctgaggatatttgtgcagctgtcgagtatatt
gtgggtccgcagcgcagatggaacagtagctgcgatgaagtttgcgagtttcggcgcgca
atcagcagagcgtacctgaatgaatggaaggcttttcagtctgtccatccatcggtgcca
gagcgcctcgcgacgcgcagcctgccgcaggtgttttctgtacctcctcttcaaaaggca
caaatggatcttctgatgcagatgtgcccgaggaatgcggagacgggagatggcagcatt
tcgatgcgtctgtggtatttagatagtgcagggtccagatgctctacgaggcgaaggttt
ccattcgacactgccgccgatgacgccatccggctcacgatgagcagcgcacgggagttt
gcaagcatgagggaaaaaactgatgatacgccgctcatctttgtcttccgtgttaagggg
cgaaacgagtacatttacggttcgcagcctctgataaattatcgttacattcgtcactgt
gtgagcaagcgggctgagatagatttggttgtggagcctaaagaagcgacccttttcgca
gtaccactgtttcgcccgtcctacccgtctcggacccttgcaagtccttctgacgcagat
gcgtcgaagtccagtacctctgaaatctgtttgtgggacctgaccagcaagctctctatc
aggattgtcggcggttttgaaaagcttgccatctccgcgtcgcgcatgaaggatgaaaac
gtgcgcgactcttcgagcctgtactttgcagttcttgtggaggcgtatgttggcacctgg
cgttgctgcgaaccccaaatcactgactggcagctgtgcgagaatgcaaagaacagccac
agcttagctgcaagagtgtactggaaggacgggggaacggtgaccttcagcatcgatctg
tcgaatgtgccaagagagctaaagctgtgttttacgctggtggcttcctcgaccgacaga
atcgtcggtgctcgggcagccactgcagaggaggtgattgccgctgtggaagtgaacacg
aagaaaaccgacgatcagggtcactcggtttttttcttgggtacggccgccacgcagctt
ttcgattacgctgcaaaaatgcggatgggtatgtggcgcatctatctatgggagggcaag
acccgcgcgaacccgattggcttgaactctatcaaccccgattccaacgcgtgcacgttt
gaggtggagttcccgtgtttcgacaagcctgtttttttccccagtggtcgacctccaaag
agaaaagaggaggatgctcgacgaaactttgctgaccgtgaggccgccctgagcagctat
ctgatcaacaacgaagtagaacaactgcgccagctgaagcgggtgctgatgtacgatccc
ctggtgcacctctcgagtgacgacaagactattctgtggaagtacagggagatgctccta
ggccaaccaaaggcgatggccaaggtgatgagtgcggtgaactggctgatgccgttcgat
gtgtacgaggcacactgccttttgcgccgatggtccccgctggctgcgttcgatgcgctg
gagctgcttgacgcgcattatgctgacttggcggttcgtgagcaggcggtggagtacatt
gataaaatgtcggactatgagctgcgcggttgtattctgcaactcgtgcaggtactcaag
tacgagccgtatcactactctgccttggcgcgttttctccttaggcggtcgcttcgctcg
aaccacataattggccactacgttttttggtatctagctgccgaagtcaagaatctgacc
atttgcgagcgacacggactccttttggaggaactgatcaagcgatctccgcaccggttg
gactacgtgcggcaagtgtacgtttgcaacgagctgctgaagtgtgcactgagggtgcaa
cgggcgccgaagaaagatcgtgtcaagtgtctgcgcgcgagtctcgctaaggtgcgattt
cctcaccgctttactctcgctctgaacccctcagtggagtgctgcgcggtcgatatcgat
gagtgcaaggtcatggagtcgaagaagttcccgctatggcttgcttttcgaaatcatctc
gatcaagacgagcactttttcatcatattcaagtctggcgacgacctcaggcaagacctg
cttactctgcagctgctggagttcatggacagcctgtggaaagcgtccggtctggacctt
cacctcatcccatacggttgcatctctaccggagaaggcgttggcatgatcgaagtggtg
ttgaacagtgacacgatcgccaacatcacgagacgcgagggtggggcacaggctgcgttc
aacgttgacccgatcataaattggttacgtcagttcaaccatgaccgaggtgaagtggag
cggtgtctgtggaatttcgtgcttagtgtcgccggctacacggtggccacctacgtcctg
ggcatcggtgacagacataatgataacatcatgctccgccaggatggcaccctctttcac
atcgattttggccactttctgggcaacttcaagacgaagttcggcatcaagcgtgagaca
gcgcctttcatttttactcccatgtacctgtatgcgatgggtgggtcaagtagcccgatc
tttaagtactttgtggacgtagcatgccgagcgtacaacgcgctgcggcggcacagcagc
gcacttatgatgctctttatgctgatgctctctacgggcataccggagctacaaaccctg
gaagatatcgagtggctgcgcacagtacttcttcttaaccgaaccgatgaggaagcctcc
gatcactacaaaggcctcatcaacgacgcactgggcaattttcgcacactgctgaacgac
tacatccatattatggtgcactga

DBGET integrated database retrieval system