KEGG   Leishmania infantum: LINJ_14_0520Help
Entry
LINJ_14_0520      CDS       T01112                                 

Definition
putative stearic acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lif  Leishmania infantum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lif01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lif01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14:complement(190605..192008)
Genome map
AA seq 467 aa AA seqDB search
MLQAVQNLFTCSVLSTDETKPKEEREVPQWSKGNFQYNWIGIYIIGVPLLFVLLGLCLRV
PLSFSLLQWLAFFGVVTGMVGVTTGYHRLFSHGAFTGGQAMQWVCAFIGAGAFQGSIKWW
ARNHRVHHKYTDTSKDPYDARRGFIFTHFGWFVMRMDYDLLGDADVSDLKDSLVVEFQRK
YFAAIATMTGILIPLMVAGATTGEWAGAFFWVVWLKIFLVHQFSFFINSLAHTDLFGATR
PYADDKTPHDSVVFAIINLGEGYHNYHHQFPNDYRNGHLWYHIDMTKWYIFMCSFLGFCD
NLQRAPRTVVDRAAAVQAVCTHGRKLQEAVEKVKQLEVPADKEYAWDDVRAEVEQGRKLL
VMDGYVLDLERPIPVDPAWAQTDKKISWLNTHPGGRALLLAYVGKDATAAFNGGVYGHTT
GARSYLPELRVGHMKERPASSASGKEGSAAVCKGQCITLPRRRDVLL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggccgtgcagaacctcttcacctgcagcgtcctttccacggatgaaacgaag
cccaaagaggagcgtgaggtgccgcagtggtcgaagggcaacttccagtacaactggatc
ggcatctacatcatcggtgtgccactgctgttcgtgctgcttgggttgtgcctgcgcgtc
cctttatccttctcgcttctgcaatggcttgcattttttggtgttgtcaccggcatggtg
ggggtgacgaccggctatcatcgtctcttctcacacggtgctttcaccggcgggcaggcg
atgcagtgggtgtgcgccttcatcggtgccggcgcgttccagggctccatcaagtggtgg
gctcgaaaccaccgcgtccaccacaagtacacggacacctccaaggacccgtacgacgcg
cgccgcggcttcatcttcacgcactttggctggttcgtcatgcgcatggactacgatctg
ctcggcgacgcagatgtgtccgacctgaaggacagcctcgtcgtggagttccagcgcaag
tactttgccgccattgcgaccatgacagggatcctgatccctctcatggtggccggcgca
accactggtgagtgggcgggtgcgttcttctgggtggtgtggctcaagatctttctggta
caccagttctccttcttcatcaacagcctcgcgcacacggacctctttggcgccacgagg
ccgtacgcggatgacaagacaccgcacgactccgtcgtcttcgcgatcataaacctcggc
gagggctaccacaactaccaccaccagttcccgaacgactaccgcaacggtcatctgtgg
taccacattgatatgacgaagtggtacatatttatgtgcagctttctgggcttctgcgac
aacttgcagcgtgcgccgcgcactgtcgtcgaccgcgccgccgcggtgcaggctgtgtgc
acgcacgggcgcaaacttcaggaggcggtcgagaaggtgaagcagctggaggtgccggcg
gacaaggagtacgcgtgggacgacgtgcgggcggaggtggagcagggccgcaagctgctg
gtgatggacggctacgtgctggacctcgagcggccaatccccgtggaccctgcgtgggcg
cagacggacaagaagatcagctggctgaacacgcaccctggtggacgagcgctgctgctt
gcgtacgtgggcaaggacgcgacggccgccttcaacggcggtgtgtatggccacacgacg
ggcgcgcgcagctacctgccggagctgcgcgtgggccacatgaaggagcgccccgcctct
tcggcgtctggcaaggaggggagtgccgcggtttgtaaggggcagtgcattacgctacct
cggagacgtgacgttctcctgtga

DBGET integrated database retrieval system