KEGG   Leishmania infantum: LINJ_15_0050Help
Entry
LINJ_15_0050      CDS       T01112                                 

Definition
putative cytochrome-b5 reductase (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lif  Leishmania infantum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LINJ_15_0050
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     LINJ_15_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15:complement(12903..13742)
Genome map
AA seq 279 aa AA seqDB search
MWSTTQQSEHLAAKCAKKPVNTFSPDSYKPFKLISSRYESHDTRRFYFALDSPDDSFYMP
VASCIIAKYTDADGKDVARPYTPISSNSTKGHFELVVKKYPKGKMGNYLFSMQPGDELLV
KGPFEKFAYKPNMWKHVGMIAGGTGISPMYQVIRAVLENPKDKTNISLIYANNQRRDILL
ANELIEMQKVYNNFNMYLTLLEVPHRWLGGIGYVNSAMVTTFMPKPGEKNTKILVCGPPP
MMQAISGDKLFEPGKPPQQGQVSGLLKTLGYTEEQVFKY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtggagtaccacgcagcagtcggagcacttagcggccaagtgtgccaagaaaccagtg
aacacgttctcccccgatagctacaagccattcaagttgatttcctctcggtacgagtcg
cacgatacgcgccgcttttactttgccctcgatagccccgatgatagcttctacatgcca
gttgcttcgtgcattatcgcgaagtacaccgatgcagacggcaaggacgttgctcggcca
tacactcccatctcctctaatagcaccaagggccactttgaactcgttgtgaagaagtat
ccaaaaggaaaaatgggcaactatctgttctccatgcaaccaggcgacgaactgctcgtc
aagggcccctttgagaagtttgcgtacaagcccaacatgtggaagcacgtgggcatgatt
gccggcggcaccggcatctctccaatgtaccaggtgattcgtgccgtgctagagaatccc
aaagacaagaccaacatttctctcatctatgccaacaaccaacgccgcgacattctgctt
gctaacgagctgattgagatgcagaaggtctacaacaacttcaacatgtatttgaccctt
ctggaggtgccgcaccggtggctaggcggtatcggctatgtgaatagtgccatggtaacc
acctttatgccgaagccgggggagaagaacacgaagatcctcgtatgtggcccccctccg
atgatgcaggccatcagcggcgacaagctatttgagcctggcaagccgcctcagcagggc
caggtaagtggcctgctgaaaacgctaggctacacggaggagcaggtcttcaagtactga

DBGET integrated database retrieval system