KEGG   Leishmania infantum: LINJ_15_0310Help
Entry
LINJ_15_0310      CDS       T01112                                 

Definition
putative replication Factor A 28 kDa subunit
Orthology
K10739  
replication factor A2
Organism
lif  Leishmania infantum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lif00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LINJ_15_0310
   03420 Nucleotide excision repair
    LINJ_15_0310
   03430 Mismatch repair
    LINJ_15_0310
   03440 Homologous recombination
    LINJ_15_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15:109462..110235
Genome map
AA seq 257 aa AA seqDB search
MLASTPGSNFGGAVASSNNSGGQQPQRRMHPIRPLTIKQMLEAQSVGGGVLVVDGREVTQ
ATVVGRVLGYENANMASGGGAITAKHFGYRITDNTGMLVVRQWIDADRMQEPLPLNTHVR
ASGTVNVWQQNPIVTGTVVSMADSNEMNYHMLDAILTHFRLTQGNKRAPSSGVSIQNTAS
AVGMHNMLPGGDIKVLLTDLLVSFIKQHGSSGAGMSMDELTTSAQRYGFTHGDVRTAMRT
LAAEGKVYQTHDNRFNI
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcttcgacccctggcagcaacttcgggggcgccgttgcatcctcgaacaacagt
ggtggccagcagccgcagcgtcgcatgcacccaattcgcccgctcaccatcaagcagatg
ttggaggctcagagcgttggcggtggtgttctggtcgtggacggccgcgaggtgacgcag
gcgaccgtcgtaggccgtgtgttgggctacgagaacgccaacatggcttctggtggtggc
gccatcactgccaagcactttgggtaccgaatcaccgacaacacgggcatgctcgtcgtg
cgccagtggatcgatgcggacaggatgcaggagccccttccccttaacacgcacgtccgc
gcgtctggcacagtgaatgtgtggcagcagaaccccatcgtcaccggcactgtggtgagc
atggcggacagcaacgaaatgaactaccacatgttggacgccattctgacgcacttccgc
ctgacacagggcaacaagcgtgccccgagcagtggtgtctcgatacagaacacggcctcg
gccgttggcatgcacaatatgctgcctggaggcgacatcaaggtgctgctgacagacctc
cttgtctctttcatcaagcagcacggcagcagcggagctggcatgtcgatggatgaacta
acgacgtcggcgcagcgctacggcttcacccatggcgatgtgcgcactgcgatgcggacg
ttggcagcggaggggaaagtgtaccagacccacgacaaccgcttcaacatctga

DBGET integrated database retrieval system