KEGG   Leishmania infantum: LINJ_15_0310Help
Entry
LINJ_15_0310      CDS       T01112                                 

Definition
(RefSeq) putative replication Factor A 28 kDa subunit
  KO
K10739  
replication factor A2
Organism
lif  Leishmania infantum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lif00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LINJ_15_0310
   03420 Nucleotide excision repair
    LINJ_15_0310
   03430 Mismatch repair
    LINJ_15_0310
   03440 Homologous recombination
    LINJ_15_0310
DNA replication proteins [BR:lif03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    LINJ_15_0310
DNA repair and recombination proteins [BR:lif03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     LINJ_15_0310
   MMR (mismatch exicision repair)
     LINJ_15_0310
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     LINJ_15_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
15:109462..110235
Genome map
AA seq 257 aa AA seqDB search
MLASTPGSNFGGAVASSNNSGGQQPQRRMHPIRPLTIKQMLEAQSVGGGVLVVDGREVTQ
ATVVGRVLGYENANMASGGGAITAKHFGYRITDNTGMLVVRQWIDADRMQEPLPLNTHVR
ASGTVNVWQQNPIVTGTVVSMADSNEMNYHMLDAILTHFRLTQGNKRAPSSGVSIQNTAS
AVGMHNMLPGGDIKVLLTDLLVSFIKQHGSSGAGMSMDELTTSAQRYGFTHGDVRTAMRT
LAAEGKVYQTHDNRFNI
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcttcgacccctggcagcaacttcgggggcgccgttgcatcctcgaacaacagt
ggtggccagcagccgcagcgtcgcatgcacccaattcgcccgctcaccatcaagcagatg
ttggaggctcagagcgttggcggtggtgttctggtcgtggacggccgcgaggtgacgcag
gcgaccgtcgtaggccgtgtgttgggctacgagaacgccaacatggcttctggtggtggc
gccatcactgccaagcactttgggtaccgaatcaccgacaacacgggcatgctcgtcgtg
cgccagtggatcgatgcggacaggatgcaggagccccttccccttaacacgcacgtccgc
gcgtctggcacagtgaatgtgtggcagcagaaccccatcgtcaccggcactgtggtgagc
atggcggacagcaacgaaatgaactaccacatgttggacgccattctgacgcacttccgc
ctgacacagggcaacaagcgtgccccgagcagtggtgtctcgatacagaacacggcctcg
gccgttggcatgcacaatatgctgcctggaggcgacatcaaggtgctgctgacagacctc
cttgtctctttcatcaagcagcacggcagcagcggagctggcatgtcgatggatgaacta
acgacgtcggcgcagcgctacggcttcacccatggcgatgtgcgcactgcgatgcggacg
ttggcagcggaggggaaagtgtaccagacccacgacaaccgcttcaacatctga

DBGET integrated database retrieval system