KEGG   Leishmania infantum: LINJ_16_1390Help
Entry
LINJ_16_1390      CDS       T01112                                 

Definition
putative cytochrome c
Orthology
K08738  
cytochrome c
Organism
lif  Leishmania infantum
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:lif00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16:complement(529770..530111)
Genome map
AA seq 113 aa AA seqDB search
MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGANGVGPNLFGIVHRPSGKVEGFTYS
KANAESGVVWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaggctcgtgcccctctgccgcctggcgacgtggagcgcggcgagaagctg
ttcaagggccgtgctgcccagtgccacaccgccaccaagggcggcgcgaacggtgtgggc
ccgaacctgttcggcatcgtccaccgcccctccggcaaggtcgagggcttcacgtacagc
aaggcgaacgccgagtcaggcgtagtctggacgccggaagtgctggacgtgtacctggag
aacccgaagaagtttatgcctggcacgaagatgtcgtttgccggcatcaagaagccgcag
gagcgcgctgacgtgatcgcgtacctcgagactctcaagtaa

DBGET integrated database retrieval system