KEGG   Leishmania infantum: LINJ_17_1200Help
Entry
LINJ_17_1200      CDS       T01112                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase-like protein (EC:1.3.99.5)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     LINJ_17_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17:518706..520328
Genome map
AA seq 540 aa AA seqDB search
MSADARIAIIAVVHLALTWVLLRYIADSAMPFYVHREGSSPAGAANGASVRRAVAHEWDQ
WSPFLVPSQEAYAAQLGRQQRATSAADAVALNSRVVWRSSAFHLTLAIFTYALLRFGVTA
PYGRHSWSLGFQLTLPSRVSWMLQESPTIFQVIYHVFLEYPRLMGHSPSWPSLWPSSSSA
SGPTAAGMPSSHSSADTCHSYWGCVRAACTQQHLGLLLFVIHYVHRSWLYPLSIPATAHD
VPLVVTWMATMYCLFNGRLQVLASAGAAATACATDTAAPSLACTPAYTASMGFVRCWRER
HELQSLPSSSASVGAVAVRVGWRLLLGLYAVGVLGGSALFFLGQRINMQADYYLVRLRRG
DKGSISHGGSKPVGRRAANLHGDALATSSSLEASRDAQHRSSIDGYRIPVGGWFDSVSCA
NFFGELVEWTGYVIVVAATSAASNGNCLSVTTALEEELLQPLSSSSWWSLMNPIMWLRLV
ARVFFGGSESRPAALAAFSFLVYVFSNLAPRAVAHHAWYAKTFGDPYTRLGRQALIPGVY
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgatgcgcgtattgctatcatcgccgtcgtgcaccttgcgctgacgtgggta
ctgctgcgctacatcgccgattcggccatgcccttctacgtgcaccgcgaaggcagcagc
cctgccggtgccgccaacggtgcctctgttcgcagggcggtagcgcacgaatgggaccag
tggtcgcccttcctcgtgccgagccaggaggcgtacgctgcacagctcggccgacagcag
cgcgcgacatcggctgccgatgctgtcgccctcaacagtcgtgtggtgtggcgcagcagc
gcgttccacctcacgctcgccatcttcacatacgcgttgctgaggtttggcgttacggcc
ccttacggccgtcactcctggtccctcggcttccagcttaccctcccctcgcgcgtcagc
tggatgttgcaggagagtccgaccatcttccaggtgatctaccacgtttttctggagtac
ccgcgcctcatggggcacagcccttcatggccatcgctgtggccatcgtcctcctctgcc
tccggcccgactgctgctgggatgcccagcagccattcttcggcggacacatgccattcc
tactggggctgtgtgcgggccgcctgcacgcagcagcaccttggactcctgctctttgtt
atccactacgtccaccgcagctggctctatccgctgtcgatccccgccaccgcacatgat
gtgccgctcgtcgttacgtggatggcgaccatgtactgtctcttcaatggccgcctacag
gtgctggcgagcgcaggtgcggctgccacggcctgtgcaaccgacacagcagcgccgtcg
ttggcatgcactcccgcgtacacggcgtcgatgggctttgtgcggtgttggcgcgagcgc
cacgagctgcagtccctcccctcctcctccgcctccgtcggagctgtcgcggttcgcgtt
ggctggcggcttcttttgggcctctacgctgttggcgtcttgggcggctcagcgctgttc
ttcctcggacaaaggattaacatgcaggcggactactacctggtgcgtctgcgccgcggt
gacaagggcagcatcagccacggtggcagcaagccggtcggacggagggcggcgaatctg
cacggggatgcgctggcgacgtcgtcgtcgcttgaggcgtctcgtgatgctcagcaccgc
agcagcattgacggctatcgcatccccgtcggcggctggtttgactccgtcagctgcgcg
aacttcttcggcgagcttgtcgagtggacgggctacgtcatcgtcgtcgcggcgacttct
gctgctagcaacggcaactgcctctccgtgacgactgccctcgaggaggaactacttcaa
ccgctctcgtcgtcgtcttggtggtcactgatgaacccgatcatgtggctgcgcctcgtt
gcgcgcgtgttcttcggcgggtcggagtcacgcccggcagcgctggcggcgtttagcttc
ctggtgtacgtcttcagcaacttggccccgcgtgcggtggcgcatcatgcgtggtacgcc
aagacgttcggtgatccctacacgaggctcggccgccaggcgctcatacccggtgtgtac
tag

DBGET integrated database retrieval system