KEGG   Leishmania infantum: LINJ_18_1040Help
Entry
LINJ_18_1040      CDS       T01112                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
lif  Leishmania infantum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LINJ_18_1040
Enzymes [BR:lif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LINJ_18_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18:423573..426050
Genome map
AA seq 825 aa AA seqDB search
MRRRVVDTEGGAVHVSGSAPTWRGRRSRRAFFSLLLLSIALSAMICSLLVLGWIAADDST
TVFGDDFAASDAWLNSNSNQEKWQRALLQSAKLNLPVPHSVAMNQVFFISCNRHDRSQLY
WAYMAVAAQCEMLSWKNATAAPPCRRLYAGVSSLLRTAGTAASSGGPHGRTTDTDEGKWQ
EAVPLGACGSVYDSPAAAEQRQRYRRTSPPLLLLDETPPPLHRDTDPEQCFRAAPRDAVY
STGVPVDALIWLGDIIYADKFPDGRDAQSLLFHHVNTMVSIGRFWRIQRDAPEYNAFIDS
CVAGGDHLDWTLHSPGEVFLPAAADNRERVVQLTPSPSSGTHRNVWATWDDHDMGENDGG
REYTGRNSTQRFFLNFLRAPSSDPRWRREGVYGAYTTDFRDVVDDAKGWGTPMRLLMQQL
YEHAICVVLLDVRSFRDRPNATQAGDMLGAEQWAWFEELLQNYTTLTRDGRERCAMVLIG
GGIQFILDEKPAENWAAFPRSRDRLLGLLQAYRVERVAFITGDVHMGELGVDFTKHAIEE
VLGYPIVEATSSGLTHSANMYFLPTFMPLLFPSPRRLGLYVGTNFGALRLSLDLRHLPLI
RSYLTEMESKMAAARFRPPQWRREVRAAVEQVVNATFTIFSIPKGGQPVYRLNFPLSMLT
YAHGVAYRDATVDAVHGSVHKKPTSSPAAPEKNGGKEAAKDDTERTSSSPLRALLVLKNG
TITGIAHYRNTEPTPLITWSARQLQYYIFTNFSVSETLKLMILLGFSAGALVLLLLMTTL
CRYLRRPRNSCSRFYYSNVAPSPQVSLVTRCSKKRVNNQWNNIDK
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgacgtgtcgttgatacagagggcggcgcggtgcatgtcagtggctccgcacca
acttggcgaggccggcggtcccggcgcgccttcttctctctcttgctgctctccatcgcg
ctgtccgctatgatatgttccctgcttgtcctgggctggatcgcagccgatgactcgact
actgttttcggcgacgacttcgcagccagcgacgcttggttgaactccaatagcaaccaa
gagaagtggcagagagcactactccagtctgcgaaactcaacctccccgtccctcacagc
gtagccatgaatcaagtcttcttcatcagctgcaatcggcatgatcgcagtcagctctac
tgggcctatatggcagttgcagcacagtgtgagatgctgtcctggaagaatgctacggcg
gcgccgccttgtcggaggctctacgccggtgtgtcctcgttgctacgcaccgccggtacc
gccgcctcttcaggtgggccgcacggacgcacgacagacacggatgaaggaaaatggcag
gaggcggttcctctcggtgcatgcggctccgtgtacgactctcccgcggcagcggagcag
cgtcagcgataccggcggacctcgccgccgctgctgctgctggatgagactccgcctccg
cttcaccgcgacaccgaccctgagcagtgctttcgtgctgcaccacgtgacgccgtctac
tcaaccggcgttccggtggacgccttgatctggctaggggacatcatctacgccgacaag
ttcccggatggcagggacgcgcagtcgctcctgttccaccacgtcaatacaatggtaagc
atagggcgattctggcgaatccagcgcgacgctccggagtacaacgcgttcatcgacagc
tgcgtcgcaggtggcgatcatctggactggacgctgcactcaccaggggaagtgtttctg
cccgcagccgcggacaatcgcgagcgagttgtgcaactcaccccttcgccctcctccggc
actcaccgcaatgtgtgggccacctgggatgaccacgacatgggcgagaacgatggtgga
cgagagtacaccggccgtaacagcacgcagcgcttctttctgaactttttgcgagccccc
tcaagtgatccacgctggcgtcgcgagggcgtgtatggtgcatacacgaccgactttcgc
gacgtcgtggacgacgccaaggggtggggaactccaatgcggctcctgatgcagcagctt
tatgagcatgccatctgcgttgtcctcctcgacgttcgctcgttccgcgaccgcccgaac
gcgacccaggccggcgacatgctcggcgctgagcagtgggcgtggtttgaggagctcctg
cagaactacacgacactgacgcgagacgggcgagagcggtgtgcgatggtgctcataggg
ggcggcattcagttcatcctggatgagaagcccgcagaaaactgggcagccttcccccgc
tctcgggaccgcctcctcggactactgcaagcctaccgggtcgaacgcgtggccttcatc
accggcgatgtgcacatgggtgagctgggcgtcgacttcaccaagcacgccattgaggag
gtgctggggtacccaatagtggaggccacgagctcggggttgacacacagtgcgaacatg
tactttctccccacattcatgccactgctcttccccagcccacggcgtctcggcctctat
gtggggacgaacttcggtgcgttgaggctctccctggacctgcgtcacctgcctttgatc
cgctcatacttgacagagatggagtcgaagatggcggcggcacgctttcggccaccacag
tggcgccgggaagtccgcgctgccgttgagcaagtcgttaatgctactttcaccatcttc
tccatcccaaaaggcggccaaccagtgtaccggctaaacttccctctctctatgctcacc
tacgcgcacggtgtagcgtatcgcgacgccacagtagatgcggtgcatgggagtgtgcac
aagaagccaacgtcatccccagcggcgccggaaaagaacggcggcaaagaggcagcgaag
gacgacacggagcgcacatcatcgtcgccgctgagggcgcttctcgtgcttaagaacggt
accattacgggcatcgcccactaccgcaacaccgagcccacaccgctcattacgtggtcg
gcgcgccagctgcagtactacattttcaccaacttctccgtctccgagacgctgaagctg
atgatcctgctcgggttctcggccggggctttggtgctcttgctgctgatgaccacgcta
tgtcggtacctgcggcggccacgaaacagctgcagcagattctattactctaacgtagca
ccctcgcctcaagtgtccctcgtgacgcggtgttcgaagaagagggtgaataaccagtgg
aacaacatagataagtag

DBGET integrated database retrieval system