KEGG   Leishmania infantum: LINJ_18_1090Help
Entry
LINJ_18_1090      CDS       T01112                                 

Gene name
PKAC1
Definition
protein kinase A catalytic subunit (EC:2.7.11.1)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LINJ_18_1090 (PKAC1)
Protein kinases [BR:lif01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   LINJ_18_1090 (PKAC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18:450379..451377
Genome map
AA seq 332 aa AA seqDB search
MITKAEASKWRLSDLEMRETVGTGTFGRVRLVKHKGTGQYAALKILKKQEILRMKQVDHV
MAEASLLQEIDHPFIVSMLRGYMDKNRLYILLEYVVGGELFSHLRKAGKFPNDVSKFYCA
EVILAFDYLHNKTIVYRDLKPENILLDQDGNIKITDFGFAKRVTERTFTLCGTPEYLAPE
IIQSKGHNKAVDWWALGILLYEMLVGYPPFFDDSPMKIYEKILVGKVLFPRWVDSKARDF
IKGLLSLDPTKRLGSLPNGTEDIKNHKYFAEVDWNVVLSKKIPAPIPVRQHKEGDTHYFD
KYPDSPLNSLRTLTPAQQDCFANFCNGQYTDE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccaaggccgaagcttccaagtggaggctgagcgacttggagatgcgtgagacg
gtcggcaccggcactttcggccgagtacgcttggtgaagcacaaaggaacaggccagtac
gcggccctcaagatcctcaagaagcaggagattctccgaatgaagcaggtcgaccacgtg
atggcggaggcaagtcttctccaggagatcgaccacccttttattgtgagcatgctgcgg
ggatacatggacaagaaccggctgtacatactcctcgagtacgtggtaggcggcgagctg
ttctcgcatctccgcaaggccggcaagttccctaatgatgtctcgaagttctactgcgcc
gaggtgatcctagcatttgactacctgcacaacaagacgatcgtttaccgcgatctgaag
ccggagaacattctcctcgaccaagacggtaacataaagatcacggatttcggattcgcg
aagcgcgtgacggagcgtacgtttacgctttgtggcacacctgagtacctagcccccgag
atcattcagagcaaggggcacaacaaggctgtcgactggtgggcgctcggcatcctgctg
tacgaaatgctggttggctacccgccgttcttcgacgacagcccgatgaagatctacgag
aagatccttgtgggcaaggtgctcttcccgcgatgggtagactcgaaggcccgagacttc
atcaagggccttctatccctcgatcccacgaagcgccttggcagtttgcccaacggcacg
gaggacatcaagaaccacaagtactttgcggaagtggactggaatgtagtgctgtccaag
aagattcccgcgccgatcccggtacggcaacacaaggagggcgatacccactacttcgac
aagtaccccgacagcccactcaactctttgcgcactttgactccagcacagcaggactgc
ttcgcaaacttctgcaacggccagtatacggacgagtag

DBGET integrated database retrieval system