KEGG   Leishmania infantum: LINJ_19_0030Help
Entry
LINJ_19_0030      CDS       T01112                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
lif  Leishmania infantum
Brite
Chromosome and associated proteins [BR:lif03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    LINJ_19_0030
Exosome [BR:lif04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LINJ_19_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF Connexin
Motif
Other DBs
NCBI-GeneID: 5068393
NCBI-ProteinID: XP_001464983
UniProt: A4HY42
Position
19:complement(7832..8239)
Genome map
AA seq 135 aa AA seqDB search
MGSATASQPTFAVQPPSLYYISHPPHTTMASSRKASNPHKSHRKPKRTWNVYVGRSLKAI
NAQMSMSHRTMKIVNSYVNDVMERICTEAASIVRANKKRTLGAREVQTAVRIVLPAELAK
HAMAEGTKAVSSASR
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgggctctgcgacagcttcccagcccaccttcgctgtccagccaccctcgctctactac
atctcccacccccctcacaccaccatggcttcttcccgcaaggcttccaacccgcacaag
tcgcaccgcaagcctaagcgcacgtggaacgtgtacgtgggccgctcgctgaaggcgatc
aacgcccagatgtcgatgtcgcaccgcacgatgaagatcgtgaactcgtacgtgaacgac
gtgatggagcgcatctgcactgaggccgcgtcgattgttcgcgcgaacaagaagcgcacg
ctgggtgcgcgcgaggtgcagacggcggtgcgcattgtgctgccggcggagctcgcgaag
cacgccatggctgagggcacgaaggccgtgtcgagcgcgtcccgctaa

DBGET integrated database retrieval system