KEGG   Leishmania infantum: LINJ_19_1520Help
Entry
LINJ_19_1520      CDS       T01112                                 

Definition
eukaryotic translation initiation factor-like protein
Orthology
K03259  
translation initiation factor 4E
Organism
lif  Leishmania infantum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lif00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LINJ_19_1520
Translation factors [BR:lif03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    LINJ_19_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19:635306..636151
Genome map
AA seq 281 aa AA seqDB search
MDPNRCAPASTVTDEQPLTLLWGTWEMWCDMPQRQQGQGTENTNWLEQVKSIGLFDSAEG
FWGIFNCTILPSQLPPNGSYYLFRKHIAPMWEHEANRRGGKWVIPFTGKSSRSEGDLQPV
DEAWQTLCLSAIGELFPGDEEEVCGVTVSRGRQRTLPSGHATSVLSEWKLCLWTRSADNR
GSQMRIAEYIRKQLHLQSLSKETSRDGKSGENDTLMEMPRSPDRSPVAKTREASSIPSAM
TYVAHRDLMEAKQEFVKGGSSVAQAFRPKYTLAIDVRGEAV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggatccgaatagatgtgccccggcgagtactgtaacagatgagcagccgcttactctg
ctgtgggggacgtgggagatgtggtgcgacatgccgcagcgacagcaaggccagggcaca
gaaaataccaactggctggagcaagtgaagagtattggcttgttcgacagtgccgagggc
ttctggggaattttcaactgcaccatcctgccatcgcagcttccaccgaacggctcctat
taccttttccgaaaacacattgccccaatgtgggagcacgaggcaaaccgcagaggcgga
aagtgggtgattccctttaccggcaagtcgtcgcggagtgagggcgatttgcagccggtc
gatgaggcctggcagacactgtgcctctctgcgattggggagctctttcccggtgacgag
gaggaggtctgcggcgtcactgtgagtcgcgggaggcagcgcaccttgccctctggccat
gcgacgtctgtgctaagtgagtggaagctttgcctgtggactcgcagtgccgacaacagg
ggatctcaaatgcgcattgcagagtacattcgcaagcaactgcacttacagtccctgtcg
aaggaaaccagcagggatggaaaaagcggcgaaaatgacacactgatggagatgccgcgg
tctccagaccgttctccagttgccaagacgcgagaggcgtctagtattccgtcagcaatg
acctatgtggcgcaccgggacttgatggaggcaaagcaggagtttgtaaagggcggcagc
agcgttgctcaagcgttcaggcccaagtacactcttgcaatcgatgtgaggggtgaagct
gtgtga

DBGET integrated database retrieval system