KEGG   Leishmania infantum: LINJ_20_0310Help
Entry
LINJ_20_0310      CDS       T01112                                 

Definition
developmentally regulated phosphoprotein-like protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     LINJ_20_0310
Protein kinases [BR:lif01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   LINJ_20_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20:102770..104128
Genome map
AA seq 452 aa AA seqDB search
MRRLLPIKKLLGSTAGFRLASTKSSGTERLERLVEEVNGIKSKLKVLEESKAANGLVDLY
ASRKMKRLDIKRILSIFNDRAYHAPIFCHKALPIILAHFITGLDKLPSGLNAMPSILAVR
ATLLRSFQKLINCKIPATDDQVQHFRRVLEDIDEEHAERDLLQTMAFGILELKEYVSSHR
RALVDLKKTSERWASIPMTEENVLTYAEIQDIQAPLDSVNRCMITYNFISRMFLNHDPDM
TMGSNPRRIGMVDLEMNLEHVVRNAVDEAKQICTDHYGDCPDTEFEFTSDSKAFRFPYMS
TTIRYIILELMKNAFRATVDSHMKRNDVGMVTCADMPPVRVLINLQEGTEHACICISDEG
MGMTDEALAMAMAYSYTSVSKPALQLGDSGEGCASTAPSPLAGYGYGLPMSRVYAQSLGG
DLFLQTMEGYGTRAYYYIKIADAQPLCDEETK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgattgcttccgattaagaagttactcggctccacggccgggttccgtttggca
tcgacgaaaagctcgggcacagagcgcctagagaggctcgtggaggaggtgaatggcata
aagtcgaagctgaaagttctggaagagagcaaagctgcaaacggattggttgacctttac
gcctctcgcaaaatgaaaaggctggacattaagcgtatcctgagtatcttcaacgatagg
gcgtaccacgcgccaatattctgccacaaggcgcttccaattattttggcgcacttcatt
accggacttgacaaacttccttctggcctcaacgccatgccgtcgattttggccgttcgt
gcaacgcttctccgctcgtttcagaagctcatcaactgcaaaatccctgccaccgacgac
caagtgcagcactttcgcagagtgttggaggacattgacgaggagcacgcagagcgcgac
ctgctgcaaaccatggcatttggaatcctggagctgaaggagtacgtttcatctcatcgg
cgagcactggtggatcttaagaagacatccgagcggtgggccagcatccccatgacggag
gagaacgtgctcacctacgcagagatccaagacatccaagccccactggactctgtgaat
cgttgtatgatcacgtacaacttcatctctcgcatgttcctcaaccacgacccggatatg
actatgggcagcaatcccagacgcatcgggatggttgatcttgagatgaatcttgagcac
gtagttcgcaacgctgttgacgaggcgaagcagatttgcacggatcactacggcgactgc
ccagacaccgagtttgagttcacctcagactccaaggctttccgattcccctacatgagc
acaactatccggtacattatactggaactgatgaagaacgcgtttcgtgcgacagtggac
tcacacatgaagcgcaacgacgttgggatggttacgtgcgctgatatgccgcctgttcgc
gttttgatcaacctacaagaagggacggagcatgcgtgcatctgtatctcggatgaaggc
atgggcatgacggacgaagcacttgccatggcaatggcgtactcatacacgtcagtcagc
aaaccagctctgcagcttggtgactcgggcgaggggtgtgcatccacggcgccatcgccg
ctggctggctacgggtacgggcttccgatgtcgcgcgtgtacgcacagtcgcttggtggc
gaccttttcttgcagaccatggagggctacggtacgcgcgcctactattatatcaagata
gcggatgcacaacccttatgcgacgaggaaaccaagtag

DBGET integrated database retrieval system