KEGG   Leishmania infantum: LINJ_20_0980Help
Entry
LINJ_20_0980      CDS       T01112                                 

Definition
putative 1,2-Dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lif  Leishmania infantum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LINJ_20_0980
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     LINJ_20_0980
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     LINJ_20_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20:391639..392673
Genome map
AA seq 344 aa AA seqDB search
MTDCWYIPEAVADRRDENRLSPNVPASYEVLGEVGIFYRHFDPKEVSDDIEGFIQPLLKK
LNYQSYDVVNLSPANLGAEKFETLAEQHFMEHIHEDDEVRLILEGQGYFDVRDINDKWIR
LLSKPGDCIVVPAGMYHRFTTDQSKDIKTLRIFKEAPRWIALNRGPEAEEKPARKEYLAR
LHAPAETAVGAANGRTIFSLRYPLKLDVELTAITKRLLEQHSKRPLALAIYLTGSTDPTT
GESWCPDCVLAKPHVATRFAELRGKYGEERAIFLQLPVERASYLGNPNFPYRTHPTLQLA
SVPTLLVLTPAKDAKEKGDVQWHDLLDVKVRTCDADKADVLSLE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactgctggtacataccagaggcggtcgcggatcgccgcgatgagaatcgtctt
tcgccaaacgtgcccgccagctacgaggtgcttggtgaagtagggatcttctaccgtcac
ttcgacccgaaggaggtaagcgatgacatcgagggtttcatccagccgcttctcaagaag
ctcaactaccagagttacgacgtcgtgaacctcagcccggccaacctcggcgcagagaag
ttcgagactctggcggagcagcatttcatggagcacattcacgaagacgatgaggtgcgg
ttgattctcgaaggtcagggctactttgacgtgcgcgatatcaacgacaagtggattcga
ttgctgtcgaagcctggcgactgcatcgttgtaccagccggcatgtatcaccgcttcacg
acggatcagagcaaggacatcaagacgctgcgcatcttcaaggaggctccgcggtggatc
gcgctgaaccgcggcccggaggcggaggagaagccggcgcgcaaggaatacctcgcccgc
ctgcacgcccctgccgaaacggctgtcggtgccgccaacggccgcacgatcttctctctg
cgctacccgctgaagctggacgtggagctcaccgccattacgaagcgactgctggagcag
cacagcaagcgaccgcttgccctcgcgatttatctgaccggctccaccgacccaaccacc
ggcgagtcctggtgcccggactgcgttctggcgaagccgcacgtcgcgacgcgctttgca
gagctccgaggcaagtacggtgaggagcgcgccatcttcctgcagctcccggtcgagcgc
gccagctacctgggcaacccgaatttcccctatcgcacgcacccgaccctgcagctggct
agtgtgccgacgctgctcgtgttgacgccggccaaggacgccaaggagaaaggcgacgtg
cagtggcacgacctgctcgacgtcaaggtgcgtacctgcgatgctgacaaggcagatgtg
ctgagccttgagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system