KEGG   Leishmania infantum: LINJ_21_0460Help
Entry
LINJ_21_0460      CDS       T01112                                 

Definition
putative cysteine peptidase, Clan CA, family C19
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LINJ_21_0460
Peptidases [BR:lif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LINJ_21_0460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21:122932..125097
Genome map
AA seq 721 aa AA seqDB search
MGNETSKSSGTASASNPLRRNSQSEAAVGFGGAPAATEKAGSPNAASTAASVPSRPIALS
AETPPLRSASGATDTVGSSVPRYVDAKSMVYTLPCFTPDRSLSSPTSGGAGPRSQPIAIQ
MAASQQLPMMSSSSDLRVGAPSSPLSPSRRHFSAANLSNTMEIPTYNTSTPTAVEDLSCS
SPVLKSYRQHSFSHSKRDACLADSPNSPDMSVHGGASLSAGASEAPVAMSLATSFSPGAG
SGSPSTAIHTKFLEITGHPLGLENYGNTCYCNSVIQLIYHCAPLRLRLLELYHVYLTKKG
KSGFEEDTVLFQLCSLIAVMHKSNNRTKDKYPREKIAPKELLNCVRAKNEVFNNDMQQDA
HEFTMFLLNDIWDTEQRIMADPANVNLFLKHETSMKKKGSLSFSWKHSKDKHISSHSHKE
NRLDKTTSAAATNSDAGANGGKAVDAQQPFSGELTPLQVILQGQFGSLTACLECENVTAR
EEVFMDLSLETAQGTSLLRCLDHFGDPEYFWGKNKLRCEECKMPVRAAKTIHVQQLPQYA
LLIHLKRFQYDVKKQIFTKKADHVALPMQMDVEEYLTDPEVIEQSLRNKLARSQKNSGVD
AVSSTSGHNNSGSGQKDEANATSSTDTFKPASEDVRRKLRGVARHKARFELTGFVAHIGE
GPNSGHYFTCVRYGPQLWRRFDDETVSTMAERDVKQYFGVPSDAVGVVTTTAYILLYERV
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgagacgtccaagtccagcggcacggcgtcggcgagcaacccacttcgccgg
aactcgcagtcggaggcggcagtgggcttcggcggtgctcccgcggcgacagaaaaggcg
ggatcgccaaatgctgcgagcaccgctgcatcggtccccagccgtcccatagcgctgtcg
gccgagacgccaccactgagatcggcgagtggggccacggacaccgtcggctcgtcagtg
ccgcgctacgtggatgcaaagagcatggtgtacacccttccctgctttaccccggatagg
tcgctgagcagcccgacgagcggcggcgctggtccacggagccaaccgatcgcaatacag
atggctgcctcacagcagctgccgatgatgtcctccagcagtgacctccgcgtgggtgcg
ccatcctcgcctctctccccatcccgccggcacttctccgctgcgaatttgtcgaacacg
atggagattccgacgtacaacacaagcacccccaccgccgtggaggacctttcctgcagc
tcacccgtgctcaaatcgtaccggcagcactccttctcccattcgaagcgggatgcgtgt
ctggccgactcccccaactccccagacatgagcgtccacggcggcgcatccctcagcgcc
ggcgcctcggaggctccggtggcgatgagcctggccacctcgttctcacctggggctggc
agcggctcgcccagcacagcgatccacacaaagttcctcgagataaccgggcacccgctg
ggcttggagaactacggcaacacttgctactgcaactccgtcatccagctgatctaccac
tgcgccccactgcggctgcggctgctcgagctgtaccacgtctacctcaccaagaagggt
aagtctggcttcgaggaggacacggtgctcttccagctctgcagcctcatcgccgttatg
cacaagtcgaacaaccgcaccaaggacaagtacccgcgcgagaagatcgccccaaaagaa
ctgctgaactgcgtgcgcgccaagaacgaggtcttcaacaacgacatgcagcaggacgca
cacgagttcaccatgtttctgctgaatgatatctgggacacggagcagcgcatcatggcc
gaccccgccaacgtaaacctctttctcaagcacgagacatccatgaagaagaaggggtcg
ttgtccttctcctggaagcacagcaaggataagcacatcagcagccacagccacaaggaa
aacaggctcgacaagacaacctcggcagcggccaccaacagcgacgccggcgcgaacggg
ggcaaggcggtggatgcacagcagcccttcagcggggagctcacccctctccaggtaatc
ctgcaaggccagttcggctccctcaccgcctgcctcgagtgcgagaacgtgaccgcccga
gaggaggtcttcatggacctcagcctcgagacggcacagggcacgtccctcctccgctgc
ctcgaccacttcggtgaccccgagtacttctgggggaagaacaagctgcgctgcgaggag
tgcaagatgccggtgcgcgccgccaagacgatccacgtgcagcagctgccgcagtacgcg
ctccttatccacctgaagcgcttccagtacgacgtgaagaagcagatcttcacaaagaag
gcggaccacgtcgcactgccgatgcagatggacgtggaggagtacctgacggacccagag
gtgatcgagcagagcctgcgcaacaagctggcgcgctcgcagaagaacagcggcgttgac
gcggtcagcagcaccagcgggcacaacaacagcggcagcggacagaaagacgaagcgaac
gcgacttcgtcgaccgacacattcaagccggcgtcggaggacgtacgccgcaagcttcgt
ggcgtcgcccgccacaaggcgcgcttcgagctgacaggttttgtcgcccacattggcgag
ggaccaaactcagggcactacttcacgtgtgtccgctacggtcctcagctgtggcgccgc
ttcgacgacgagactgtgtcgacgatggcggagcgagatgtgaagcagtactttggcgtt
ccatccgacgctgtcggcgtggtcacgacgacggcctacatactgctctacgagcgcgtt
gcgtag

DBGET integrated database retrieval system