KEGG   Leishmania infantum: LINJ_21_0610Help
Entry
LINJ_21_0610      CDS       T01112                                 

Definition
dihydrolipoamide acetyltransferase precursorlike protein (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lif  Leishmania infantum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LINJ_21_0610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LINJ_21_0610
   00020 Citrate cycle (TCA cycle)
    LINJ_21_0610
   00620 Pyruvate metabolism
    LINJ_21_0610
Enzymes [BR:lif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LINJ_21_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21:complement(172216..173400)
Genome map
AA seq 394 aa AA seqDB search
MMRRTLLWLVNFEPVFMPALSPSMETGTVVEWKKKVGELVKESEVFCTIQTDKAVVDYTN
TFESGYLAKIYCGNGQSAPVAKTIAVMVSDAADVSKADEYTPEGEVPAADAEAPAAAAVA
AAPAAGGASSEVPEGVTCEPVFMPALSPSMETGTVVEWKKKVGELVKESEVFCTIQTDKA
VVDYTNTFESGYLAKIYCGNGQSAPVAKTIAVMVSNAADVEKVANYYPEDAVGGPPASAA
DPSAAAAAAASARPAASAASAKHYGGSLDAAVAASGPSVARIAAGLEPSALAGIAPSGKG
GRFLKSDFSGQPGFDYNDTAPARAMQQKAAPAAAADGASKAAAKPAAPAAVSGDIYNVVL
KPGPVYKSVSDTALLKKLMCSMHIPKPKSKKAAE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggcgcacgctgctctggctcgtgaacttcgagcccgtcttcatgccggccctc
tccccgtcgatggagacaggcacggtggtcgaatggaagaagaaggttggcgagctcgtg
aaggagagcgaggtcttctgcaccatccagacggacaaggcggtagtggactacacgaac
accttcgagagcggctacctcgccaagatatactgcgggaacggccagtctgcccccgtc
gccaagacgattgctgtgatggtgagcgacgccgcggatgtcagtaaggcggacgagtac
acgcctgagggcgaggtgcctgccgcggacgcggaggcacccgccgctgctgctgttgcc
gctgcgccggccgctggtggtgcctcctctgaggtgccggaaggcgtcacctgtgagccc
gtcttcatgccggccctctccccgtcgatggagacaggcacggtggtcgaatggaagaag
aaggttggcgagctcgtgaaggagagcgaggtcttctgcaccatccagacggacaaggcg
gtagtggactacacgaacaccttcgagagcggctacctcgccaagatatactgcgggaac
ggccagtctgcccccgtcgccaagacgattgctgtgatggtgagcaacgctgccgatgta
gagaaggttgccaactactaccccgaggatgcagttggcgggccgccggcctccgccgct
gacccttctgccgccgctgctgctgctgcgtcagctcgaccggctgcatcggccgcgtct
gccaagcactacggtggctcgctcgatgcggcggtggcggctagtggcccaagcgtggcc
cgcattgctgctggtctggagcccagcgctctcgccggcatcgctccctctggcaagggt
gggcgtttcctgaagtccgacttttctggtcaacccggtttcgactacaacgacaccgcg
ccggcgcgagcgatgcagcagaaggcggcccccgccgctgccgctgatggggcgagtaag
gcggctgcaaagcctgctgccccggcggcggtaagcggggacatctacaacgttgttctc
aagcccggccctgtgtacaagagcgtcagcgacacggccctgctgaagaagctcatgtgc
tccatgcacattccgaagccaaagtcgaagaaggccgccgagtaa

DBGET integrated database retrieval system