KEGG   Leishmania infantum: LINJ_21_0740Help
Entry
LINJ_21_0740      CDS       T01112                                 

Definition
putative histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LINJ_21_0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21:complement(206779..208071)
Genome map
AA seq 430 aa AA seqDB search
MHAVHKDDARAPLLNTESRCRVALIDTSGYASDMNISAFVPQHAMKPYRVLAAMEIVRSL
KIDAHCRTVVPPLVKVEELMAYHTDTYLANLGLHSCRSWLWNAETSKVFFSGDCPPVEGL
MEHSIATASGTLMGAVLLNSGQVDVAVHWGGGMHHSKCGECSGFCYVNDIVLGILELLKC
HDRVLYVDIDMHHGDGVDEAFCTSDRVFTLSLHKFGESFFPGTGHPRDVGYGRGRYYSMN
LAVWDGITDFYYLGVFEHALHSIVRRYSPDAIVLQCGADSLAGDRLGLLNLSSFGHGQCV
QAVRDLGIPMLALGGGGYTIRNVAKLWAYETSILTGHPLPPNTVLPVAEMPLSGWLFQDS
PLLIVAQDRSNHVLPGLHCQRAYQMMTEQIDRHVPHIQPHPRLQKASTAAAAVDKQVEDG
TTAVEDFKRQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcggtgcacaaggatgatgccagggcaccgcttttgaataccgaaagccgctgc
cgcgtggcgttgattgacacctccggctacgcctccgacatgaacatctctgcctttgtg
ccccagcacgcaatgaagccgtatcgtgtgcttgcggcaatggagattgtgcgcagcctc
aagatcgatgctcactgccgcactgtcgtgccgcctctggtgaaggttgaggagctgatg
gcataccataccgacacctacctcgcgaacctaggcctgcacagctgccgcagctggttg
tggaacgcggagacgtcgaaagttttcttttctggagattgtcctccggtcgaggggctg
atggagcactccatcgctacagccagcgggacgttgatgggagcggtactactcaatagc
ggccaggtcgacgtggcggtgcactggggtggcggaatgcatcattcaaagtgcggcgag
tgctccgggttctgctacgtgaacgacatcgttctcggtattctcgagcttctgaagtgc
catgaccgggttctgtacgtcgacatcgatatgcaccacggcgacggcgtggatgaggcc
ttctgcacgagtgatcgcgtctttacactctcactgcacaaattcggtgagagcttcttc
cctggcacggggcacccgcgcgacgtcggctacggtcgtggacgctactacagcatgaat
ttggctgtatgggacggcatcaccgacttctactaccttggcgtatttgaacatgcgctg
cactccatcgtgcggcgctactcaccagatgcaattgtgctccagtgcggcgccgactcg
ctcgctggtgatcgcctcggcttgcttaacctgtcgtcttttggtcatgggcagtgcgtg
caggcggtgcgtgatctcggtattccgatgctggcgctcggtggcggcggctacacgatt
cgcaacgtcgcaaagctgtgggcgtatgagaccagtatcttgactggtcacccactaccg
ccgaacacggtgctcccggttgctgagatgccgctgagtgggtggctctttcaggactca
cccctgctgattgtcgcgcaggaccgcagcaatcacgtcttaccagggcttcactgccag
cgtgcgtaccagatgatgacggagcaaatcgaccgccacgtgccgcacattcaaccgcat
ccgcggctgcaaaaggcgtccaccgcagcagcagcagtggacaagcaggtggaggacggc
acgacagccgtcgaagatttcaagcgacagtaa

DBGET integrated database retrieval system