KEGG   Leishmania infantum: LINJ_21_1990Help
Entry
LINJ_21_1990      CDS       T01112                                 

Definition
putative calcineurin B subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
lif  Leishmania infantum
Brite
Protein phosphatases and associated proteins [BR:lif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     LINJ_21_1990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21:complement(702149..702676)
Genome map
AA seq 175 aa AA seqDB search
MNEIPLTAEELQNIRESTALTDAQVQRLYKSFSKLNKDKSGKITRAEFNSIPALASNPLV
DRVLAVMDTDGDSTVDFGDFVRALAVLSSATSKEDKLRFTFKMYDIDGDGRISNKDLFQM
LSIMVGVNLSQMQLQQIVDKTFIEADADRDGYITFEEFEALAVNSDFGDRLNLHF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagattccactcacagcggaggagctgcagaacatccgcgagtccacggcgctc
acggacgcgcaagtgcagcggctgtacaagagcttttccaagctgaacaaggacaagtct
ggcaagatcactcgagcggagttcaactcgatccctgcactagcctccaacccactcgtc
gacagggtgctggcggtgatggacacggacggcgactccacggtggactttggggacttt
gtgcgggcactagcggtgctctcctcggcgacctcgaaggaagataagctgcggttcacg
ttcaagatgtacgacatcgacggtgacggccgcataagcaacaaggacctctttcaaatg
ctcagcatcatggttggggtgaacctctcccagatgcagctgcagcagattgtggacaag
acattcatcgaggcggatgctgatcgggacggctacattacgtttgaggagtttgaggcg
ctggccgtaaacagcgactttggcgatcggctgaacctgcacttttag

DBGET integrated database retrieval system