KEGG   Leishmania infantum: LINJ_22_1530Help
Entry
LINJ_22_1530      CDS       T01112                                 

Definition
putative phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lif  Leishmania infantum
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LINJ_22_1530
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LINJ_22_1530
Enzymes [BR:lif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LINJ_22_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22:641781..644135
Genome map
AA seq 784 aa AA seqDB search
MRARGTPSHTRSAPHFFHAFLVSTLPYRPTLSIEAASTTSHRAAKHCHTIRARHSYTAPE
LCVCACVALPSSDMGVLCNTASNPEKRTATYIPALRALTDKYFATQHPNENESALFFASL
RVALRSMLHCSREEVDEFLIDSCKRSVSTSAALDKFLSNKNTSKVAPDATAAKIMQVWMM
YDKDNSGDLSYAEMKRLVEGLSFSKDLTERILKPFEDDNRHTIAFSEFAKVYSNAVSFRE
LGYVFQDLAGGQQTISRDTFASFVCDIQGEDWDAEFLNEKLALMGCVGTDGITENNFVGY
VMSPYFDSAVKKKKLTDVYHDMDQIMCCYFISSSHNTYLTGDQLTSKSSSQMYKKALLDG
CRCVELDCWNGPQGEPIVYHGYTRTSRIAFEECVKTIRQYAFTASAYPVILSLEVHTSVE
QQDRMAEILEGGLGSLLFRPPWGSNEKPTMTFSPNNLKNKILVKAKRGDFPAREPRVDKD
DDATETDSVASTNNADYLKMKETCRKAEKDEVRVSAKLSALVSIESSKCHDVKDLSYLKD
KQPYHCSSYSERKGKAIAREAHDALVRINDTCLSRVFPAGSRIDSSNYSPLLYWASGFQM
VAINWQSSDTFGWRLNRCFFLDNGCCGYLLKPDHLRPVTCPDVAVPENWRSLTVEVISGF
SLPSASNSEVADPFVTVFLEGPDVDSTPKSTHTIHNNGFHPVWRGAGQTEWIWTVHRWSL
SVLVLQVYDHNRCSSSQLLAEAIIPLRMLHKGFRKVSLNDSAGYNIPGSFLVCRVDYTGA
PERL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgcggggcactcccagccacacgcgctctgccccgcacttcttccatgccttt
ctcgtatccaccctcccctaccggcctacactttccatcgaagcagcatccaccacttcg
caccgcgccgcaaagcactgccatacgatacgcgcgcgccattcatacacggcgcccgag
ttgtgcgtgtgcgcatgtgtggcccttccctcgtcagacatgggtgtcctctgcaacacg
gcgagcaaccctgaaaaacgcaccgccacgtacatcccggcgctcagggcgcttacggac
aaatacttcgccactcaacacccgaacgaaaatgaatctgccctcttttttgcttcgctg
cgagtggcactgcgcagcatgctgcactgcagcagggaagaggtggatgagttcctaatc
gattcttgcaaacgcagcgtgagcacaagcgccgcgctcgacaagttcctgtcgaacaaa
aacacatcaaaggtggcgccagatgccacggctgccaagatcatgcaggtgtggatgatg
tacgacaaagacaatagcggcgatttgagctacgccgagatgaagcgtctggtcgagggg
ctcagcttttcgaaggacttgacagagcgaatcttgaagcccttcgaggacgacaatcgc
cacaccatcgccttttccgagtttgcgaaggtgtactcgaacgccgtgagtttcagggag
ctcggctacgtcttccaggatttggcggggggccagcagaccatctctcgcgacaccttc
gccagctttgtatgcgacatccaaggcgaggactgggatgccgagtttctcaacgagaag
ctcgctcttatgggctgcgtcggcaccgacggcatcacggagaataacttcgtcgggtac
gttatgagtccctacttcgactccgcggtgaagaagaagaagctgacggacgtctaccac
gacatggaccagatcatgtgctgctacttcatcagctcctcacacaacacgtacctcacc
ggggaccagctcacgagcaaatcctcctcccagatgtacaaaaaggcgcttctcgacggg
tgccggtgcgtggagcttgattgctggaacggccctcagggcgagccgattgtgtaccac
ggctacacccgcacttctcgtatagccttcgaagagtgcgttaagacgattcgccagtac
gcctttaccgcttccgcataccccgtgatactctcactggaggtgcatacttcggtggag
cagcaggatagaatggcggagattctagaaggaggactgggctcgttgctcttccggcct
ccgtggggctccaacgagaagcccaccatgaccttctcacccaacaacttaaagaacaaa
attctcgtgaaagcgaagcgcggcgacttcccggcccgcgagcctcgcgttgacaaagac
gacgacgcaaccgagacggactcggtggcgagcacaaacaatgccgactacctgaaaatg
aaggagacttgcaggaaggccgagaaggatgaggttcgggtgtcagcgaagctgtccgcc
cttgtctccatcgagtccagcaagtgccacgacgtcaaggacttatcatacctgaaggac
aagcagccgtaccactgctcttcgtactcagagaggaaggggaaggccatcgcccgcgag
gcccacgacgcgctggtgcgcatcaacgacacgtgccttagccgcgtcttccctgcgggc
tcgcgcatcgacagcagcaactacagtccgctgctttactgggcgtctggcttccagatg
gtggccatcaattggcagtccagcgataccttcggctggcgcctcaaccgctgctttttc
ctcgacaacggctgctgcgggtacctcctgaagccagaccacctgcggcccgtgacctgc
cccgatgtggccgtcccggagaactggcggtcgctgacagtggaagtgatttcaggcttc
tcgctgccgagcgcgagcaattcagaggttgccgatccgtttgtgacagttttcctcgag
ggccccgacgtggacagcacgccaaagagcacgcacacaatccataacaacggctttcac
cctgtctggcgcggagcggggcagacagagtggatatggacggtacatcggtggtccctg
tcggtcctcgtgctccaggtctacgaccacaacaggtgcagctcatctcagctgctcgca
gaggccatcattcctctgcgtatgcttcataaaggattccgcaaggtgtccttgaatgac
tccgcgggctacaacatacccggcagctttcttgtgtgccgcgtcgactacacgggtgca
ccagagcggttgtga

DBGET integrated database retrieval system