KEGG   Leishmania infantum: LINJ_22_1530Help
Entry
LINJ_22_1530      CDS       T01112                                 

Definition
(RefSeq) putative phosphoinositide-specific phospholipase C
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lif  Leishmania infantum
Pathway
lif00562  Inositol phosphate metabolism
lif01100  Metabolic pathways
lif04070  Phosphatidylinositol signaling system
lif04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LINJ_22_1530
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    LINJ_22_1530
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    LINJ_22_1530
Enzymes [BR:lif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LINJ_22_1530
Membrane trafficking [BR:lif04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    LINJ_22_1530
 Endocytosis
  Macropinocytosis
   Phospholipase C
    LINJ_22_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_7 EF-hand_1 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 5069090
NCBI-ProteinID: XP_001465668
UniProt: A4I027
Position
22:641781..644135
Genome map
AA seq 784 aa AA seqDB search
MRARGTPSHTRSAPHFFHAFLVSTLPYRPTLSIEAASTTSHRAAKHCHTIRARHSYTAPE
LCVCACVALPSSDMGVLCNTASNPEKRTATYIPALRALTDKYFATQHPNENESALFFASL
RVALRSMLHCSREEVDEFLIDSCKRSVSTSAALDKFLSNKNTSKVAPDATAAKIMQVWMM
YDKDNSGDLSYAEMKRLVEGLSFSKDLTERILKPFEDDNRHTIAFSEFAKVYSNAVSFRE
LGYVFQDLAGGQQTISRDTFASFVCDIQGEDWDAEFLNEKLALMGCVGTDGITENNFVGY
VMSPYFDSAVKKKKLTDVYHDMDQIMCCYFISSSHNTYLTGDQLTSKSSSQMYKKALLDG
CRCVELDCWNGPQGEPIVYHGYTRTSRIAFEECVKTIRQYAFTASAYPVILSLEVHTSVE
QQDRMAEILEGGLGSLLFRPPWGSNEKPTMTFSPNNLKNKILVKAKRGDFPAREPRVDKD
DDATETDSVASTNNADYLKMKETCRKAEKDEVRVSAKLSALVSIESSKCHDVKDLSYLKD
KQPYHCSSYSERKGKAIAREAHDALVRINDTCLSRVFPAGSRIDSSNYSPLLYWASGFQM
VAINWQSSDTFGWRLNRCFFLDNGCCGYLLKPDHLRPVTCPDVAVPENWRSLTVEVISGF
SLPSASNSEVADPFVTVFLEGPDVDSTPKSTHTIHNNGFHPVWRGAGQTEWIWTVHRWSL
SVLVLQVYDHNRCSSSQLLAEAIIPLRMLHKGFRKVSLNDSAGYNIPGSFLVCRVDYTGA
PERL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgcggggcactcccagccacacgcgctctgccccgcacttcttccatgccttt
ctcgtatccaccctcccctaccggcctacactttccatcgaagcagcatccaccacttcg
caccgcgccgcaaagcactgccatacgatacgcgcgcgccattcatacacggcgcccgag
ttgtgcgtgtgcgcatgtgtggcccttccctcgtcagacatgggtgtcctctgcaacacg
gcgagcaaccctgaaaaacgcaccgccacgtacatcccggcgctcagggcgcttacggac
aaatacttcgccactcaacacccgaacgaaaatgaatctgccctcttttttgcttcgctg
cgagtggcactgcgcagcatgctgcactgcagcagggaagaggtggatgagttcctaatc
gattcttgcaaacgcagcgtgagcacaagcgccgcgctcgacaagttcctgtcgaacaaa
aacacatcaaaggtggcgccagatgccacggctgccaagatcatgcaggtgtggatgatg
tacgacaaagacaatagcggcgatttgagctacgccgagatgaagcgtctggtcgagggg
ctcagcttttcgaaggacttgacagagcgaatcttgaagcccttcgaggacgacaatcgc
cacaccatcgccttttccgagtttgcgaaggtgtactcgaacgccgtgagtttcagggag
ctcggctacgtcttccaggatttggcggggggccagcagaccatctctcgcgacaccttc
gccagctttgtatgcgacatccaaggcgaggactgggatgccgagtttctcaacgagaag
ctcgctcttatgggctgcgtcggcaccgacggcatcacggagaataacttcgtcgggtac
gttatgagtccctacttcgactccgcggtgaagaagaagaagctgacggacgtctaccac
gacatggaccagatcatgtgctgctacttcatcagctcctcacacaacacgtacctcacc
ggggaccagctcacgagcaaatcctcctcccagatgtacaaaaaggcgcttctcgacggg
tgccggtgcgtggagcttgattgctggaacggccctcagggcgagccgattgtgtaccac
ggctacacccgcacttctcgtatagccttcgaagagtgcgttaagacgattcgccagtac
gcctttaccgcttccgcataccccgtgatactctcactggaggtgcatacttcggtggag
cagcaggatagaatggcggagattctagaaggaggactgggctcgttgctcttccggcct
ccgtggggctccaacgagaagcccaccatgaccttctcacccaacaacttaaagaacaaa
attctcgtgaaagcgaagcgcggcgacttcccggcccgcgagcctcgcgttgacaaagac
gacgacgcaaccgagacggactcggtggcgagcacaaacaatgccgactacctgaaaatg
aaggagacttgcaggaaggccgagaaggatgaggttcgggtgtcagcgaagctgtccgcc
cttgtctccatcgagtccagcaagtgccacgacgtcaaggacttatcatacctgaaggac
aagcagccgtaccactgctcttcgtactcagagaggaaggggaaggccatcgcccgcgag
gcccacgacgcgctggtgcgcatcaacgacacgtgccttagccgcgtcttccctgcgggc
tcgcgcatcgacagcagcaactacagtccgctgctttactgggcgtctggcttccagatg
gtggccatcaattggcagtccagcgataccttcggctggcgcctcaaccgctgctttttc
ctcgacaacggctgctgcgggtacctcctgaagccagaccacctgcggcccgtgacctgc
cccgatgtggccgtcccggagaactggcggtcgctgacagtggaagtgatttcaggcttc
tcgctgccgagcgcgagcaattcagaggttgccgatccgtttgtgacagttttcctcgag
ggccccgacgtggacagcacgccaaagagcacgcacacaatccataacaacggctttcac
cctgtctggcgcggagcggggcagacagagtggatatggacggtacatcggtggtccctg
tcggtcctcgtgctccaggtctacgaccacaacaggtgcagctcatctcagctgctcgca
gaggccatcattcctctgcgtatgcttcataaaggattccgcaaggtgtccttgaatgac
tccgcgggctacaacatacccggcagctttcttgtgtgccgcgtcgactacacgggtgca
ccagagcggttgtga

DBGET integrated database retrieval system