KEGG   Leishmania infantum: LINJ_22_1530Help
Entry
LINJ_22_1530      CDS       T01112                                 

Definition
putative phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
lif  Leishmania infantum
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:lif00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:lif04070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22:641781..644135
Genome map
AA seq 784 aa AA seqDB search
MRARGTPSHTRSAPHFFHAFLVSTLPYRPTLSIEAASTTSHRAAKHCHTIRARHSYTAPE
LCVCACVALPSSDMGVLCNTASNPEKRTATYIPALRALTDKYFATQHPNENESALFFASL
RVALRSMLHCSREEVDEFLIDSCKRSVSTSAALDKFLSNKNTSKVAPDATAAKIMQVWMM
YDKDNSGDLSYAEMKRLVEGLSFSKDLTERILKPFEDDNRHTIAFSEFAKVYSNAVSFRE
LGYVFQDLAGGQQTISRDTFASFVCDIQGEDWDAEFLNEKLALMGCVGTDGITENNFVGY
VMSPYFDSAVKKKKLTDVYHDMDQIMCCYFISSSHNTYLTGDQLTSKSSSQMYKKALLDG
CRCVELDCWNGPQGEPIVYHGYTRTSRIAFEECVKTIRQYAFTASAYPVILSLEVHTSVE
QQDRMAEILEGGLGSLLFRPPWGSNEKPTMTFSPNNLKNKILVKAKRGDFPAREPRVDKD
DDATETDSVASTNNADYLKMKETCRKAEKDEVRVSAKLSALVSIESSKCHDVKDLSYLKD
KQPYHCSSYSERKGKAIAREAHDALVRINDTCLSRVFPAGSRIDSSNYSPLLYWASGFQM
VAINWQSSDTFGWRLNRCFFLDNGCCGYLLKPDHLRPVTCPDVAVPENWRSLTVEVISGF
SLPSASNSEVADPFVTVFLEGPDVDSTPKSTHTIHNNGFHPVWRGAGQTEWIWTVHRWSL
SVLVLQVYDHNRCSSSQLLAEAIIPLRMLHKGFRKVSLNDSAGYNIPGSFLVCRVDYTGA
PERL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgcggggcactcccagccacacgcgctctgccccgcacttcttccatgccttt
ctcgtatccaccctcccctaccggcctacactttccatcgaagcagcatccaccacttcg
caccgcgccgcaaagcactgccatacgatacgcgcgcgccattcatacacggcgcccgag
ttgtgcgtgtgcgcatgtgtggcccttccctcgtcagacatgggtgtcctctgcaacacg
gcgagcaaccctgaaaaacgcaccgccacgtacatcccggcgctcagggcgcttacggac
aaatacttcgccactcaacacccgaacgaaaatgaatctgccctcttttttgcttcgctg
cgagtggcactgcgcagcatgctgcactgcagcagggaagaggtggatgagttcctaatc
gattcttgcaaacgcagcgtgagcacaagcgccgcgctcgacaagttcctgtcgaacaaa
aacacatcaaaggtggcgccagatgccacggctgccaagatcatgcaggtgtggatgatg
tacgacaaagacaatagcggcgatttgagctacgccgagatgaagcgtctggtcgagggg
ctcagcttttcgaaggacttgacagagcgaatcttgaagcccttcgaggacgacaatcgc
cacaccatcgccttttccgagtttgcgaaggtgtactcgaacgccgtgagtttcagggag
ctcggctacgtcttccaggatttggcggggggccagcagaccatctctcgcgacaccttc
gccagctttgtatgcgacatccaaggcgaggactgggatgccgagtttctcaacgagaag
ctcgctcttatgggctgcgtcggcaccgacggcatcacggagaataacttcgtcgggtac
gttatgagtccctacttcgactccgcggtgaagaagaagaagctgacggacgtctaccac
gacatggaccagatcatgtgctgctacttcatcagctcctcacacaacacgtacctcacc
ggggaccagctcacgagcaaatcctcctcccagatgtacaaaaaggcgcttctcgacggg
tgccggtgcgtggagcttgattgctggaacggccctcagggcgagccgattgtgtaccac
ggctacacccgcacttctcgtatagccttcgaagagtgcgttaagacgattcgccagtac
gcctttaccgcttccgcataccccgtgatactctcactggaggtgcatacttcggtggag
cagcaggatagaatggcggagattctagaaggaggactgggctcgttgctcttccggcct
ccgtggggctccaacgagaagcccaccatgaccttctcacccaacaacttaaagaacaaa
attctcgtgaaagcgaagcgcggcgacttcccggcccgcgagcctcgcgttgacaaagac
gacgacgcaaccgagacggactcggtggcgagcacaaacaatgccgactacctgaaaatg
aaggagacttgcaggaaggccgagaaggatgaggttcgggtgtcagcgaagctgtccgcc
cttgtctccatcgagtccagcaagtgccacgacgtcaaggacttatcatacctgaaggac
aagcagccgtaccactgctcttcgtactcagagaggaaggggaaggccatcgcccgcgag
gcccacgacgcgctggtgcgcatcaacgacacgtgccttagccgcgtcttccctgcgggc
tcgcgcatcgacagcagcaactacagtccgctgctttactgggcgtctggcttccagatg
gtggccatcaattggcagtccagcgataccttcggctggcgcctcaaccgctgctttttc
ctcgacaacggctgctgcgggtacctcctgaagccagaccacctgcggcccgtgacctgc
cccgatgtggccgtcccggagaactggcggtcgctgacagtggaagtgatttcaggcttc
tcgctgccgagcgcgagcaattcagaggttgccgatccgtttgtgacagttttcctcgag
ggccccgacgtggacagcacgccaaagagcacgcacacaatccataacaacggctttcac
cctgtctggcgcggagcggggcagacagagtggatatggacggtacatcggtggtccctg
tcggtcctcgtgctccaggtctacgaccacaacaggtgcagctcatctcagctgctcgca
gaggccatcattcctctgcgtatgcttcataaaggattccgcaaggtgtccttgaatgac
tccgcgggctacaacatacccggcagctttcttgtgtgccgcgtcgactacacgggtgca
ccagagcggttgtga

DBGET integrated database retrieval system