KEGG   Leishmania infantum: LINJ_23_0470Help
Entry
LINJ_23_0470      CDS       T01112                                 

Definition
aldose 1-epimerase-like protein (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lif  Leishmania infantum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LINJ_23_0470
   00052 Galactose metabolism
    LINJ_23_0470
Enzymes [BR:lif01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LINJ_23_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23:162836..164062
Genome map
AA seq 408 aa AA seqDB search
MADTQPVPATVTSAHGAHAEAFGESFIVTLSSENLRVQLLSHGAALNSVKVRKPHAAASA
TTAASATAEQDDEWLEVCLGYTNPEEALSADAVIGHTIGRYAGRIANGEFEMANTTYTLA
KNFGPHNLHGGPVGFQHQEWKYLLSDGRDETGVAFHLVSPHMDQGFPGELFVTATYSIIK
SAPVPTLKYVLQASLSDHTPVDMTVINLTNHAYWNLNGVPRPAATDAVAPLPRNIANHYL
QLQSKYFAVTDELSIPHGDMRPVEGTPHDYSALRCVAEGMEATKEEGRDGGGYDDLVALE
TWDSTLREAALVYSPATKLRMQVCTTNPAIVVYTANHLPANASGAKGQRFQQHSAICLEC
QYFPNSPNVRAFPSTVLKKGEAYNETTTHAFQFMNADITPEEKLLRRQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggccgacacgcagcctgtcccggcgacggtgacgtccgcgcacggcgcccatgctgag
gcgtttggcgagtctttcatcgtgacactgagctctgaaaacctgcgcgtgcagctgctg
tcgcatggtgcggcgctaaactccgtgaaggtgcgcaaaccgcacgccgcagcatcggcc
accactgcggcgtcggcgactgcagagcaggacgatgaatggttggaagtgtgcctcggc
tacacgaacccggaggaggcactcagcgccgatgcggtgatcggtcatactattggacga
tacgccgggcgcatcgccaatggcgagttcgagatggcgaacacgacgtatacgctcgcc
aaaaactttggcccgcacaacctccacggcggcccggtcgggtttcaacaccaggaatgg
aagtacctgttgtcggacggcagggatgagactggtgtggcgttccacctcgtctcaccg
cacatggatcagggcttccccggtgaactcttcgtgacggctacctacagcatcattaag
tcagctccagtgcccaccctcaagtacgtgcttcaagcctcgctgtcggaccacacgcca
gtggacatgacggtgatcaacctgacgaaccatgcgtactggaacctgaacggtgttccg
cgaccagcagcgacggatgcggtggcgccgctgccgcgaaacatcgcgaaccactacctg
cagttgcagtccaagtactttgccgtcaccgatgaactgagtatcccacatggtgatatg
cgtcccgtcgaaggtaccccacacgactactcggcgctgcgctgcgttgccgagggaatg
gaggcgacgaaggaggaaggtcgcgacggcggcggctacgatgacctggtcgcccttgag
acgtgggactcgaccctgcgggaggcagcgctggtgtacagtcccgctaccaagctgcgc
atgcaggtgtgcaccacgaacccagccattgttgtctacacagcgaaccacctgcctgcc
aatgcctccggcgcaaaagggcagcgcttccagcagcacagtgcgatctgcctggagtgt
cagtacttcccgaacagccccaacgtgcgagccttcccatcgacagtgttgaagaaaggc
gaagcgtacaacgagactacgactcacgcgttccagttcatgaacgctgacatcactcca
gaggaaaagctgctgcgccgtcagtaa

DBGET integrated database retrieval system