KEGG   Leishmania infantum: LINJ_23_0880Help
Entry
LINJ_23_0880      CDS       T01112                                 

Definition
putative acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lif  Leishmania infantum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lif01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lif00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lif00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lif00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23:complement(336603..338690)
Genome map
AA seq 695 aa AA seqDB search
MSSKVVSSPVTPNSPLSVSQHVCDFKRVLDSNVVEPTEANGKKSHVGPHLGSRMRIYEYS
IEHNDAFWAEIARRDFYWKTTWPDDQHVKSYNFDKSKGPIFVKWFEGAVTNVCYNALDRH
LPAHKDRVCFYFEGNDPSVTEAVTYGSMYTRVVELANVLKYQYGIAKGDRVGLYLPMIPF
AAVAMLACARIGAVASVIFGGFSAQAIVTRVTDCSPKLIITADASSRGDKPILLKTIADQ
ALDDCSVLGCNVPCLVFENMNRQSCKMKEGRDTWYGDALARLTPEQHEECPVEWMDAEDV
LFLLYTSGSTGKPKAIVHTTAGYMVYASTTFMYSFDYHMDDVYFCTADIGWITGHSYVVY
GPMIHCATSVLFEGVPNYPDYSRWWQLVEKYKVSILYTAPTAIRSLMQAGDDYVKVGNRS
TLRVLGSVGEPINVEAWKWLRDVGGEGHCDVSDTWWQTETGGHMITPMPGCTPMKPGSAT
LPFFGVQPVILDPMKLHEKQGPAEGLLAIRAPWPGMARTIYGDHARFEKTYFGVDGYYMT
GDGARRDSDGYYWITGRVDDVLNVSGHRIGTSEIEDAVNTHPAVVESAVVGFPHNIKGEG
IYVFLTFRQGTEVTPELLAAVKATVRKVIGPLATPDVLHPAQEGLPKTRSGKIVRRILRK
IATHNDDDLGDTSTLADPTVVEALKRSRAKWVDEK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaagtcgtctccagtccggtgactccgaacagcccgctgtcagtctcgcag
catgtatgcgacttcaagagggtgttggactcgaacgttgtggagccgacagaggcgaac
gggaaaaagtcgcacgtcggcccccacctcggctctcgcatgcgcatctacgagtactcc
atcgagcacaatgacgccttctgggccgaaattgcacggcgcgacttctactggaagacg
acctggccggatgaccagcacgtcaagtcgtacaacttcgacaaatccaagggccccatc
tttgtgaagtggttcgagggcgccgtgacgaacgtctgctacaacgcgttggaccgccac
ctgccggcgcacaaggatcgcgtgtgcttttactttgaaggcaacgacccgagtgtgacg
gaagcagtcacgtacggcagcatgtacacgagggtggtggagctggcgaacgtgctgaag
taccagtacggtattgcaaagggcgaccgcgttggcctgtatctacccatgatcccgttc
gctgcggtggccatgctcgcctgcgcccgcatcggtgcggtggccagtgtcatctttggc
ggattttcggctcaggcgatcgtgactcgtgtcacggactgcagcccgaagctcatcatc
actgctgacgcgtcctctcgcggtgataagccgattctgctcaagacaatcgcggaccag
gccctggacgactgcagcgtccttgggtgcaacgtcccgtgtctcgtattcgaaaacatg
aaccgtcaatcctgcaagatgaaggaaggccgagatacctggtacggcgatgccttagcc
cgactgacgccggagcagcacgaggagtgcccggtggagtggatggacgcggaggatgtg
ctgttcctgctctacacctccggcagcacagggaaacccaaagccatcgtgcacacgacg
gcgggctacatggtgtacgcctccaccaccttcatgtacagcttcgactaccacatggac
gacgtgtacttctgcacggctgatattggctggatcacaggccacagctacgtcgtgtat
ggtccgatgatccactgcgccacgtcggtgctgttcgagggtgtgccgaactaccccgac
tactcgcgctggtggcagctcgtcgagaagtacaaggtgtccatcctctacaccgcgccc
accgcgatccgctccctcatgcaggccggcgacgactacgtcaaggtgggcaaccgcagc
accctgcgtgtgctgggctctgtcggcgagccgatcaacgtggaggcgtggaagtggctg
cgcgatgtcggcggcgagggccactgcgatgtgtcggacacgtggtggcagaccgagacg
ggcggccacatgattacaccgatgccgggctgcacccccatgaaacccggtagtgcaacg
ctgccgttcttcggtgtccagccggttattctcgaccccatgaagctgcatgagaagcag
ggccccgcggagggcctgctcgccattcgcgcgccgtggcctggtatggcccgcaccatc
tacggtgaccacgcacgctttgagaaaacctactttggcgtggacgggtactacatgaca
ggcgacggtgctcgccgcgactcggacggctattactggatcacgggccgcgtcgatgac
gtgctgaacgtgagcgggcaccgcatcggcaccagcgagatcgaagacgccgtcaacacc
cacccggccgtggtggagagcgccgtcgtcggcttccctcacaacatcaagggtgagggc
atctacgtcttccttacgttccgccaggggacggaggtgacgcccgagctgctggcggcg
gtgaaggcgactgtgcgcaaggtgattggcccgctggccacgccggacgtgcttcacccc
gcgcaggaaggactgcccaaaacgcgctccggcaagattgtgcgccgcatcctgcgcaag
atcgccacgcacaacgacgacgacctgggcgacacctcgaccctggcagaccccaccgtc
gtggaggcgctgaagcgctcgcgtgcgaagtgggtggatgaaaagtag

DBGET integrated database retrieval system