KEGG   Leishmania infantum: LINJ_23_1070Help
Entry
LINJ_23_1070      CDS       T01112                                 

Definition
(RefSeq) beta-fructosidase-like protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lif  Leishmania infantum
Pathway
lif00052  Galactose metabolism
lif00500  Starch and sucrose metabolism
lif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LINJ_23_1070
   00500 Starch and sucrose metabolism
    LINJ_23_1070
Enzymes [BR:lif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LINJ_23_1070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 5069206
NCBI-ProteinID: XP_001465781
UniProt: A4I0E0
Position
23:complement(439367..440908)
Genome map
AA seq 513 aa AA seqDB search
MSSQAQQRAPAYAPRGTHAERLAAADREAAARWDSSTNCTWYPDYHLAPHTGWMNDPTGL
VHFRDHYHVFYQYHPYSAEWGPMHWGHLTSEDLVHWQHEKAALAPGDACDRDGCFSGTAV
VHEDRMYVFYTGHFVLEAATPSNPDAIFEQQCVAVSSDGVNFEKLGAVVRPPPGYVHFRD
PKVWQQDGRWWMVCGARDVTKDLGQLLLFATEDLLKWDDTNWQVLGMTEDKNVFMWECPD
YFTIGSREDMKLLLFCPQGKKASEYNYRNRFQNGYTVGQWTPGGPWRVQREFRELDRGHD
FYAAQTFLAADGQRRMLMAWCNMWESPMPTKQYGWSGCLTLPRELSYNEATGQLRMLPAR
ELVGLRTPEMMIVPTLLVENNNDAQILANCTAYELDIAFNMETSTAEKYGLWLGSGAELY
VDAQSKRLVLNRHYPQHMLSGYRSCEMPTGLLLQLHVFIDRSSIEVFVNNGEATFSSRVF
PDEGDRALRVFSVNGTADMVGGTMWKLKATVRH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcaagcgcagcagcgcgcgccggcctacgctccgcgcggcacccatgccgag
cggctcgcggccgcggaccgggaggccgctgcccgatgggactcctcgacgaactgtaca
tggtatcccgactaccaccttgcaccgcacacggggtggatgaacgacccaacggggctg
gtgcacttccgcgatcactaccacgttttttaccagtaccacccgtacagtgccgagtgg
ggtccaatgcactggggccacttgacgagcgaggatcttgtgcactggcagcacgaaaag
gcggcgctggcaccaggagacgcgtgtgatcgcgacggctgcttctctggcaccgccgtc
gtgcacgaagacaggatgtacgtcttctatacgggccacttcgtgcttgaggcggcgacg
ccaagcaacccggacgctatctttgagcagcagtgcgtcgccgtcagcagcgacggcgtg
aacttcgagaagctcggcgccgtcgtgcgcccgccaccggggtacgtgcacttccgtgac
ccgaaggtgtggcagcaggacgggcggtggtggatggtgtgtggtgcccgtgacgtgacg
aaggaccttggccagctgctgctcttcgccacagaagacctgcttaagtgggacgacacg
aactggcaggtgctggggatgacggaggacaagaacgtgttcatgtgggagtgccccgat
tactttacgatcggcagccgcgaggatatgaagctgcttcttttctgccctcaagggaaa
aaggccagcgagtacaactaccgcaatcggttccagaacgggtataccgtcgggcagtgg
acgcctggcggcccgtggagggtgcagcgggagttccgtgagcttgatcgcggccatgac
ttctacgcagcacagactttcctcgccgccgatggccagaggagaatgttgatggcgtgg
tgcaacatgtgggaaagccccatgccgacaaagcagtatggctggagcggctgcctgacg
ctgccgcgggagctaagctataatgaggcaacaggacagcttcgaatgctgccggcgcgt
gagctggtcggcctgcgtactcctgagatgatgattgtgcctaccctcctcgtagagaat
aacaacgatgcacagatcctcgcgaactgcactgcctacgagctcgatattgcgttcaac
atggaaacgagcacggcggagaagtacgggctgtggctcggctcaggggcagagctgtac
gtggacgcgcagtcgaaacggctggtgctgaaccgccactacccgcaacacatgctgagt
gggtatcgctcctgcgagatgccgacgggtttgcttctgcagctgcacgtgttcattgac
cgctcgtcgattgaggtgttcgtgaacaacggcgaggccaccttctcttcccgcgtcttc
ccggacgagggcgaccgggcactgcgcgtcttctcggtcaacgggactgcggacatggtg
ggcggtaccatgtggaagctgaaggcgacggtgaggcactga

DBGET integrated database retrieval system