KEGG   Leishmania infantum: LINJ_23_1610Help
Entry
LINJ_23_1610      CDS       T01112                                 

Definition
acetyltransferase-like protein (EC:2.3.1.48)
Orthology
K00653  
histone acetyltransferase [EC:2.3.1.48]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     LINJ_23_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23:652672..654801
Genome map
AA seq 709 aa AA seqDB search
MSDHADIDEAARKRLRAEAPSASPLPPPPAAPLLPCDASHNGESAVAAGHILVASAAPHK
EGSIASTLHTSSKEARFEGRCMPPSFHSLLGEYEVPEEAKDVEDLVGGHEDFSDLPEARR
EALLQSVRTLVKKAAGASSAEQLEHLRVKASRLHGFKDTARKSELTAAYRQLVREGAVGE
NAAVEALLVRKKGKSHSGVLVVTVFMGPGEFSCPKDCHYCPNQPGIARSYLLKEPGVLRG
FRNGWDPISQFYDRASALENNGHVVDKIELIILGGTFSFYPQRYAEEFMTASFYAANTYY
DSAPLRPMRSLAEELTMNEDARCRIIGITVETRPDYISARELRRFRSLGVTRVQLGIQHL
DDDILNIINRDCPTAKTVVAIQRLLDAGFKVDAHWMPDLPGSSFEKDMALFETLFSAENE
SFQVDQWKVYPTATVPFTKISEWYAQGKYKPYAELDNGAYMVKLLVYIMEHCPYRIRLNR
IIRDIPTTYIMGGEKRCNLRQVIEAEMRARHIRCKDIRERECKGNPVDRANTHLFTDEFR
ASEGTEFYLSVENKDRTQLYGHLRLRLRDDASREESNILPVLRGCALIRELHTYGKLIAV
SQQNTGRETQHVGVGTQLMREAERIAKERGYYRTAVIAGVGVRRYYAKLGYRLEDTYMVK
ELDEQASIITEDQVVQDDDNENSAYSSFLSTIKSFFGFQTTTPRREESA
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccacgccgacatcgacgaggcggcccgcaagcgtttgcgggcggaggctccg
tccgcctctcctcttcctcctcctcctgcagcaccgcttcttccctgtgacgcatcgcac
aacggggagtcggcagtggcggccggccacatcctggtggcctcggccgcccctcacaag
gagggcagcattgcgtcgacgttacacacaagctccaaggaggcccgcttcgagggccgc
tgcatgccgccgtctttccactcgcttctgggcgagtacgaggtgccagaggaggcgaag
gatgtagaagacctcgtgggtggccacgaggacttcagcgacctccccgaggcccgccgc
gaggcgctcctgcagtccgtgcgcacgctggtaaagaaggcggcgggggccagctccgcg
gagcagctcgagcacctgcgtgtgaaggcgtcgcgcctgcacggcttcaaggacacggcg
cgcaagtcagagctgacggcggcatacaggcagctcgtccgcgaaggcgccgttggcgag
aacgccgccgtcgaggcgctgctcgttcgcaagaaaggaaagtcgcacagtggagtgctc
gtggtgacggtgttcatgggccctggcgagttcagctgccccaaggactgtcactactgc
cccaaccagcccggcatcgcccgcagctacttgctgaaggagccgggcgtgctgcgcggc
ttccgcaacggctgggaccctatcagccagttctacgaccgcgccagcgcgctggagaac
aacgggcatgtcgtggacaagatcgagctcatcatccttggcggtacgttctctttctac
ccccagcgctacgccgaggagtttatgacggcatctttctacgccgctaacacgtactac
gactcggcgccgctgcggccaatgcgcagcttggcggaggagctgacgatgaacgaggac
gcgcggtgccgcatcattggcatcacggtagagacgcggcccgactacatcagcgcacgc
gagctgcgccgctttcgctccctcggcgtaacacgcgtgcagctcggcatccagcacctc
gacgatgacatcctgaacatcatcaaccgcgactgccccacggcgaagaccgtcgtcgcg
atccagcggctgctggacgccggattcaaggtggatgcgcactggatgcccgacctgccg
gggagcagctttgagaaggacatggcgctcttcgagacgcttttctcagctgagaacgag
tcgttccaggtggaccaatggaaggtgtaccccaccgccacggtgcccttcaccaaaatc
agcgagtggtacgcgcagggtaaatacaagccctatgcggagctggataacggtgcctac
atggtgaagctgctggtctacatcatggagcactgcccgtaccgcatccggctcaaccgc
attatccgcgatatcccgacgacgtacatcatgggcggggagaagcgatgcaacctgcgc
caggtgatcgaggctgagatgcgcgcacgccacatccgatgcaaggacatccgcgagcgc
gaatgcaagggcaacccggtcgaccgggccaacacccacctcttcacggacgagttccgc
gccagcgaggggacagagttctacctctccgtggagaacaaagatcgcacgcagctgtac
gggcatctccgcctgcgactgcgcgacgacgcgtcaagggaggaaagcaacatcctgccg
gtgctccggggctgtgctctcattcgcgaactgcacacgtacggcaagctcatcgccgtc
agccagcagaacaccggacgcgagacgcagcacgttggcgttgggacgcaactcatgcgg
gaggccgagcgcatcgccaaggagcgtggctactaccgcacggccgtaattgccggcgtt
ggtgtacgccgctactacgcaaaactcggctatcggctcgaggacacctacatggtgaag
gagctggatgaacaggcgagcatcatcacggaggatcaggtggtgcaggacgacgacaac
gagaactcagcttacagcagcttcctgagcaccatcaagtccttctttgggttccagacg
acaacacccagaagagaagaatccgcgtga

DBGET integrated database retrieval system