KEGG   Leishmania infantum: LINJ_24_0010Help
Entry
LINJ_24_0010      CDS       T01112                                 

Definition
putative pyruvate dehydrogenase (lipoamide) kinase (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
lif  Leishmania infantum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24:4520..5971
Genome map
AA seq 483 aa AA seqDB search
MSRPCLLLLGIDVVFAHISGSCINHVGRADLVMLRRGFCRSIPLLGPTFTELVERLDSFE
KEFIEWKAFRKAVESTSPKVTEAAKEIIAESMKEVKTSKVNLENPLTPEEFTELNQFYAK
QKVKDIFFENLLYINTPNDLMQHSETVFRQYLVRIARRVRHLNHAPYGLSQMPGIQMLKK
WYQWSFHDVRSTPVPTTRDECYRCDRMVRRVFLRHYNVSSLITDGMVEFASREGWTHVDE
EVMRTYDELQNFFEAFCLGRVRLRFLVGNYMYLSTKILGVSKEEYAVNDPDGLTVPIFFD
HNAEDFVGQICKKCSLLVLTKCAIKEAQASYDAEIELKLAGDPNLVFVGIPYITYDIICA
MLEDAVSANVDRQERTGKACTKIEVTLAQWPTNKRFVLRISDTAGGMTLRQASKQLSCWS
LYRNIQGHNQDTISTWTSSPIRLPYAYNAARVIGGNITLASIEGYGTDRQLYLPSTGLAG
VSL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaccctgtttacttctacttggtattgacgttgtctttgctcacatttcgggt
agctgcatcaatcacgtagggagagcagatttagtgatgcttcgtcgaggcttttgccgc
agtatcccgctcttgggacctaccttcacagagcttgtggagcggctggactcctttgag
aaggagttcatcgagtggaaggcgtttcgcaaagcggtcgagtcaacgtcgccgaaggtc
actgaagcggcgaaagagattatcgcggagagcatgaaggaggtgaagacgagcaaggtc
aacttagaaaatccgctgacgcctgaagagttcacggagttgaaccagttttacgccaag
cagaaggtgaaggatatattcttcgagaacttgctctatatcaacacaccgaatgatttg
atgcagcattcggagaccgtttttcgacagtaccttgtgcgcattgcccgccgggtacgc
cacttgaaccatgcaccgtacggcctttcacaaatgccggggatccaaatgctgaagaag
tggtaccagtggagctttcacgacgttcgcagcactccagttccaacgacccgagacgaa
tgctaccggtgcgaccgcatggtgcgccgcgttttcctccgccactacaacgtgagctct
ctcatcaccgatggtatggtggagtttgccagccgcgagggatggacgcatgtagacgaa
gaggtgatgcgcacatatgatgagctgcagaactttttcgaagcattttgcctgggtcgc
gtccgacttcgctttttggtaggcaattatatgtacctttcaaccaaaatcctcggtgtc
tcgaaggaggagtacgccgtgaatgatccagacgggctcacagtgccaatttttttcgat
cataatgcggaagactttgttgggcagatatgcaagaaatgctctctgctggtgctcaca
aagtgcgcgatcaaagaagcacaggcgagttatgatgcggagatcgagctaaaactggcg
ggggatcctaatttggtctttgttgggataccgtatatcacgtacgacatcatttgcgcg
atgctcgaggacgccgtgtctgccaacgtagatcgccaggagcggacaggcaaggcgtgc
acaaaaatcgaagtcacgcttgcgcagtggccgacaaacaagcgctttgttctgcgtata
tcggatacggcgggcgggatgactttacgccaggcttcgaagcagctgtcctgctggtct
ctttacagaaacatccagggtcataatcaggatacgatttcgacgtggacctcgagtccg
attcggctaccttatgcgtataacgccgctcgcgtgattggtgggaacatcaccctggcg
tccattgaaggctacgggacggatcggcagctttatctgccgtccacaggacttgctggt
gtgtctctgtga

DBGET integrated database retrieval system