KEGG   Leishmania infantum: LINJ_24_0420Help
Entry
LINJ_24_0420      CDS       T01112                                 

Definition
putative cysteine peptidase, Clan CA, family C12 (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LINJ_24_0420
Peptidases [BR:lif01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   LINJ_24_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24:144221..145144
Genome map
AA seq 307 aa AA seqDB search
MPSDESRWCLIESDPAVFREIIQTVGVKGVSVEDLIMLDSSMLEQYEHVYGLVLLFKWQS
SEQASPLGTVVKDAPVFFAKQVIHNACATLAIINTLCNYPDQVELGPKVQRYLSFCQELD
PEMRGSLLDSFDELREAHNSFAPHSAFTKDGPSPKDADVYHFASFVYRHGHIWELDGLQE
GPLQCREATEANYREALVEVVQRRIDDIAAKDTTGAGQGISFSLMTIVDDPVTVLEKKIA
ALRAEEKPTTALDEELAEMLSLRKKDKEANVRRRHDYNAMIVALLKSLAERGKLEKIVAE
VQAKASK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgacgagagccggtggtgcttaatcgagagcgatccggcggtgttcagggag
atcatccaaaccgtcggcgtgaagggggtctccgtggaggacctcattatgcttgactcc
tcgatgctggagcagtacgagcacgtctacggccttgtgttgctgttcaagtggcagtcg
tcggagcaggcgtcgccgctcggcaccgtcgtgaaggacgcgccggtgttcttcgccaag
caggtgatacacaacgcctgcgccacgctcgccatcataaacacgctgtgcaactacccg
gatcaggtggagctggggccaaaggtgcagagatacctgagcttctgccaggagctcgac
ccggagatgcgcggctcgcttctggacagcttcgatgagctgcgcgaggcacacaactcc
ttcgcaccacactcggcgtttacgaaagacgggccgtcgccaaaggacgcggatgtgtat
catttcgcctcctttgtataccgccacggacacatctgggagctcgatgggctgcaggag
ggcccgctgcagtgccgcgaggcgacggaggcgaactatcgagaggcgctcgtggaggtc
gtgcagcggcgcatcgacgacattgcagcgaaggacacgacgggtgccggtcagggcatc
tccttctcgcttatgacgattgtggacgacccggtcacggtgttggagaagaagattgcc
gctctccgggccgaggaaaagccgacgacggcgctcgacgaagagctggccgagatgctg
tcactgcgcaagaaggacaaagaggctaacgtgcgtcgccgtcatgactacaatgccatg
atcgtggcgctgctgaagtccctggcggaacgtggcaaactggagaagatcgtggcggag
gtgcaggcgaaggcctccaagtag

DBGET integrated database retrieval system