KEGG   Leishmania infantum: LINJ_24_0870Help
Entry
LINJ_24_0870      CDS       T01112                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lif  Leishmania infantum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lif01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lif01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lif00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lif00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:lif00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24:310284..311039
Genome map
AA seq 251 aa AA seqDB search
MSSKPQPIAAANWKCNGTTASIEKLVQVLNEHNISHDVQCVVAPTFVHIPLVQAKLRNPK
YAVSAENAIAKSGAFTGEVSMPILKDLGINWVILGHSERRTYYGETDEIVAQKVADACKQ
GFMVIACIGETLQQREANQTAKVVLSQTSAIATKLPKEAWDQIVLAYEPVWAIGTGKVAT
PEQAQEVHALLRKWVSEKIGADVAARLRILYGGSVSAGNAKTLYMKPDINGFLVGGASLK
PEFRDIIDATR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaagccgcagccgatcgctgctgcgaactggaagtgcaacggcaccaccgcc
tccatcgagaagctggtgcaggtgctcaacgaacacaacatctcccatgacgtgcagtgc
gtcgtggcaccgacctttgtgcacatcccattggttcaggcgaagctccgcaaccccaaa
tacgccgtcagcgccgagaacgcgatcgccaagagcggcgccttcaccggtgaagtgtcg
atgccgatcctgaaggacctgggcatcaactgggtcattcttggtcactcggagcgccgc
acctactacggcgagacggacgagattgtagcgcaaaaagttgcggatgcgtgcaagcag
ggcttcatggtgattgcttgcattggagagacgctgcagcagcgtgaagcgaaccagaca
gcgaaggtggtgctgagccagacgtcagcgatcgccacgaagctgccgaaggaggcgtgg
gaccagattgtgctcgcctacgagccggtgtgggccatcggcaccggcaaggtcgccacg
cccgagcaggcgcaggaggtgcacgccctgttgcgcaagtgggtgagcgagaagatcggc
gccgacgtcgccgcgaggctccgcatcctgtacggtggctccgtcagcgccggcaatgcc
aagacgctctacatgaagcctgatattaacggcttcctggtcggtggcgcgtccctcaag
ccggagttccgagacatcatcgatgcgacccgataa

DBGET integrated database retrieval system