KEGG   Leishmania infantum: LINJ_24_0870Help
Entry
LINJ_24_0870      CDS       T01112                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lif  Leishmania infantum
Pathway
lif00010  Glycolysis / Gluconeogenesis
lif00051  Fructose and mannose metabolism
lif00562  Inositol phosphate metabolism
lif01100  Metabolic pathways
lif01110  Biosynthesis of secondary metabolites
lif01130  Biosynthesis of antibiotics
lif01200  Carbon metabolism
lif01230  Biosynthesis of amino acids
Module
lif_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lif_M00002  Glycolysis, core module involving three-carbon compounds
lif_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LINJ_24_0870
   00051 Fructose and mannose metabolism
    LINJ_24_0870
   00562 Inositol phosphate metabolism
    LINJ_24_0870
Enzymes [BR:lif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LINJ_24_0870
Exosome [BR:lif04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LINJ_24_0870
  Exosomal proteins of bladder cancer cells
   LINJ_24_0870
  Exosomal proteins of melanoma cells
   LINJ_24_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5069342
NCBI-ProteinID: XP_001465915
UniProt: A4I0S4
Position
24:310284..311039
Genome map
AA seq 251 aa AA seqDB search
MSSKPQPIAAANWKCNGTTASIEKLVQVLNEHNISHDVQCVVAPTFVHIPLVQAKLRNPK
YAVSAENAIAKSGAFTGEVSMPILKDLGINWVILGHSERRTYYGETDEIVAQKVADACKQ
GFMVIACIGETLQQREANQTAKVVLSQTSAIATKLPKEAWDQIVLAYEPVWAIGTGKVAT
PEQAQEVHALLRKWVSEKIGADVAARLRILYGGSVSAGNAKTLYMKPDINGFLVGGASLK
PEFRDIIDATR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaagccgcagccgatcgctgctgcgaactggaagtgcaacggcaccaccgcc
tccatcgagaagctggtgcaggtgctcaacgaacacaacatctcccatgacgtgcagtgc
gtcgtggcaccgacctttgtgcacatcccattggttcaggcgaagctccgcaaccccaaa
tacgccgtcagcgccgagaacgcgatcgccaagagcggcgccttcaccggtgaagtgtcg
atgccgatcctgaaggacctgggcatcaactgggtcattcttggtcactcggagcgccgc
acctactacggcgagacggacgagattgtagcgcaaaaagttgcggatgcgtgcaagcag
ggcttcatggtgattgcttgcattggagagacgctgcagcagcgtgaagcgaaccagaca
gcgaaggtggtgctgagccagacgtcagcgatcgccacgaagctgccgaaggaggcgtgg
gaccagattgtgctcgcctacgagccggtgtgggccatcggcaccggcaaggtcgccacg
cccgagcaggcgcaggaggtgcacgccctgttgcgcaagtgggtgagcgagaagatcggc
gccgacgtcgccgcgaggctccgcatcctgtacggtggctccgtcagcgccggcaatgcc
aagacgctctacatgaagcctgatattaacggcttcctggtcggtggcgcgtccctcaag
ccggagttccgagacatcatcgatgcgacccgataa

DBGET integrated database retrieval system