KEGG   Leishmania infantum: LINJ_25_2210Help
Entry
LINJ_25_2210      CDS       T01112                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
lif  Leishmania infantum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lif00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    LINJ_25_2210
Translation factors [BR:lif03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    LINJ_25_2210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
25:complement(790733..791371)
Genome map
AA seq 212 aa AA seqDB search
MDDYHDDDVHSNYGYEDDEYDDAADDWEAEAAEEEQRAVAEEAARQARLEKKLATRAPVK
KEEEEEAVPEDVERAMADMRQVANDIASGSALLSGGDSEELIGNNKLTSDADVDRVGTMI
ADRLTSFSDSAHYDKLIVEVFQRLTNHLTSTHLLNEEADRVHRLREELKRAAKAKPKPVE
KAPVTQSGLDLDNFEDRGGAAVAEENEDETGW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacgactatcacgacgatgatgtgcacagcaactacggatatgaggatgacgagtac
gacgacgccgcggatgactgggaagccgaggccgcagaggaggagcagagggccgtcgcc
gaggaggcagctcgacaagcccgcttggaaaagaagctggccacgcgtgccccggtgaag
aaggaagaggaggaggaggcagtgccagaggatgtggagcgcgcaatggcagacatgcgg
caggtggccaacgacatcgcctcgggtagtgctcttctctccggaggagattcggaggag
ctgattgggaacaataagctgacttctgacgcggatgttgaccgggtaggcaccatgatt
gcagaccgcctcacgtccttttccgactccgcccactacgacaagctaatcgtcgaagtt
tttcagcgcttgaccaaccacctgacgagcacgcatctcctgaacgaggaggcggacagg
gtacaccgtctgcgcgaggagctcaagcgcgcggcgaaggcaaagccgaagccggtagag
aaagcgcctgttacgcagagcggcctcgatctcgataacttcgaggacaggggtggcgcc
gccgttgcggaggagaacgaggacgagacgggctggtag

DBGET integrated database retrieval system