KEGG   Leishmania infantum: LINJ_27_0430Help
Entry
LINJ_27_0430      CDS       T01112                                 

Definition
putative ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lif  Leishmania infantum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LINJ_27_0430
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LINJ_27_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27:119138..120127
Genome map
AA seq 329 aa AA seqDB search
MHRARNVRSHTGEYAPDILVVGSCFLDYVGYVDHMPQVGETMHSVSFHKGFGGKGANQAV
AAGRLGAKVAMVSMVGTDGDGSDYIKELERNGVDTAYMFRTGKSSTGLAMILVDTKSSNN
EIVICPNATNHFTPELLRAQTNNYERILHTGLKYLICQNEIPLPTTLDTIKEAHSRGVYT
VFNSAPAPKPAEVEQIKPFLPYVSLFCPNEVEATLITGVKVTDTESAFSAIKALQQLGVR
DVVITLGAAGFVLSENGVEPVHVTGKHVKAVDTTGAGDCFVGSMVYFMSRGRNLLEACKR
ANECAAISVTRKGTQLSYPHPSELPAGVM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgtgcgcggaacgttcgatctcatacgggcgagtatgccccagacattttggtg
gttggttcttgctttctggactatgtcggctacgtggaccacatgccgcaggtgggcgag
acgatgcactcggtgtcgtttcacaaggggtttggcggcaagggcgccaaccaagctgtg
gcggctggccgcttgggggccaaggttgccatggtgagcatggtcgggacagatggcgac
ggcagtgactacatcaaggagctggagagaaacggtgttgacacggcgtacatgtttcgc
accggcaagagctcgactggactggcgatgatcctggtcgataccaagtcatccaacaac
gaaatcgtcatttgccccaacgccacaaaccatttcacacctgagctgctgcgcgcgcag
acgaacaactacgagaggatcctgcataccgggctcaagtatcttatctgccagaacgag
ataccccttcccaccacgctcgacacgatcaaggaggcgcacagccgtggcgtgtacacg
gtgttcaacagcgctccggccccgaagccggctgaggtggagcagatcaagccgtttctc
ccgtacgtgtcgctcttctgcccgaacgaagtggaggcgacgctcattaccggcgtgaag
gtgacggacaccgagtccgcctttagcgccatcaaggcgctgcagcagctcggcgttcgt
gatgtcgtcatcacgctcggtgcggccggctttgtcctttctgaaaacggtgtcgagccg
gtgcatgtcacgggcaagcacgtcaaggcggtggacacgaccggcgccggtgactgcttt
gtcggctccatggtgtatttcatgagccgcggccgcaaccttctggaggcctgcaagcga
gccaacgagtgcgccgccatcagcgtcacgcgcaagggcacccagctgtcctacccgcac
ccaagtgagctgccggctggtgtcatgtag

DBGET integrated database retrieval system