KEGG   Leishmania infantum: LINJ_27_1520Help
Entry
LINJ_27_1520      CDS       T01112                                 

Definition
putative eukaryotic translation initiation factor eIF-4E
Orthology
K03259  
translation initiation factor 4E
Organism
lif  Leishmania infantum
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:lif03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
27:660670..661311
Genome map
AA seq 213 aa AA seqDB search
MSAPSSVPPHKMANLHKLQRAWTLWYDSPSTYNTENWEMSLVPIMTVHSVEEFFVMLRYM
KPLHALRTSSQYHFFQEGVKPMWEDPANKKGGKLWVNLDITSANGRSSNNTSGTAAADGS
AAEAKTDLDKAWENVLMATVGEYLDCVEKKDTSAEPFVTGIVMSKRKYHNRLAVWVSDAS
ATGKIEALKKALTKEASLAPIASIVFTKHGEAS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccccatcttcagttcctccccacaaaatggcgaatttgcacaagctgcagcgt
gcctggacactctggtacgatagcccgtctacgtacaacactgaaaactgggagatgtcg
ttggtgcccatcatgaccgtgcactccgtggaggagttcttcgtcatgctcaggtacatg
aagcctctgcatgccttgcgcacctcctcgcagtaccacttcttccaggaaggcgttaag
ccgatgtgggaggacccggcgaacaagaagggcggcaagctctgggtaaaccttgatatc
accagcgccaatggtcggagcagcaacaacaccagcggcaccgcggcagccgacggcagc
gcggcggaggccaagacggacctcgacaaggcgtgggagaatgttctgatggccaccgtg
ggcgagtatctcgactgtgtagaaaagaaggacacatcagcggagccgttcgtgacgggc
attgtcatgtcaaagcgaaagtaccacaaccgcctcgccgtgtgggtgagcgatgcgtcc
gcaacgggcaagatcgaggcgctaaagaaggcgctaacaaaggaggcgagcctggcgccg
atcgcatccattgtcttcacaaaacacggcgaggcgtcttag

DBGET integrated database retrieval system