KEGG   Leishmania infantum: LINJ_28_0210Help
Entry
LINJ_28_0210      CDS       T01112                                 

Definition
histone H2B variant
Orthology
K11252  
histone H2B
Organism
lif  Leishmania infantum
Brite
Exosome [BR:lif04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LINJ_28_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28:68812..69240
Genome map
AA seq 142 aa AA seqDB search
MPPTKGGKRPIPLGGKGKGKRSAGKAPKSGDDQKRRHNHKRSQHWDLYIHRALRRFFKRG
TLSKAAVRVLSSFIEDMFNRIQTEAVFVAKINKVKTLTAREIQTSARLLLPPELAKHAMS
EGTKAVAKYNASRGEAYAQGGI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgaccaagggtggaaagcgtccgatcccgctggggggtaagggcaagggcaag
cgctcggcgggtaaggcacccaagtcaggcgatgatcaaaagcgccgccacaaccacaaa
cgcagccagcactgggacctgtacatccaccgcgctctgcgccgcttctttaagcgcggc
acgctgagcaaggcagccgtgcgcgtgctttcttcctttattgaggacatgttcaaccgc
atccagaccgaggccgtctttgtcgccaagatcaacaaggtgaagactctgacagctcgc
gaaatccagacgtcggcccgtctgctgctgccgccggagctggcgaagcacgccatgagc
gagggcaccaaggctgtcgccaagtacaacgcttcccgcggggaggcgtatgctcagggt
ggcatttag

DBGET integrated database retrieval system