KEGG   Leishmania infantum: LINJ_28_0730Help
Entry
LINJ_28_0730      CDS       T01112                                 

Definition
putative serine/threonine protein phosphatase catalytic subunit (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
lif  Leishmania infantum
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:lif00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    LINJ_28_0730
Enzymes [BR:lif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     LINJ_28_0730
Protein phosphatases and associated proteins [BR:lif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     LINJ_28_0730
Transcription machinery [BR:lif03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     LINJ_28_0730
Spliceosome [BR:lif03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    LINJ_28_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28:complement(264999..265904)
Genome map
AA seq 301 aa AA seqDB search
MSVDSIIEQLLEVRGAKPGKQVQLAENDVKQLAIRTREILLSQPPLLELEAPIKICGDIH
GQYYDLIRLFENGGFPPTANYLFLGDYVDRGKQGLETICLVFAFKVKFPENFFILRGNHE
CASINRIYGFFDECKRRYNIRLWKAFTDTFNCLPVACIIDDKIFCCHGGLSPELQTMDQI
KKITRPCDVADTGLICDLLWSDPEEGLSGWGENDRGVSFTFGQDIVEKFLNKHQFELICR
AHQVVEDGYQFFAKRKLITIFSAPNYCNEFDNSGAVMTVDNELMCSFQILKPSVKKPKFY
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgactccattatcgagcagctgctcgaggtgcgtggcgcgaagccgggcaag
caggtgcagttagccgagaatgacgtgaagcagctggcgatacgcacgcgcgagattctt
ctctcgcagccgcctctgctagagctggaggcgcccatcaagatctgcggcgatattcac
ggccagtactacgaccttatccgtctcttcgagaacggcggcttcccgccgacagcgaac
tacctcttcctcggcgactacgtggaccgcggaaagcagggtctcgagaccatctgcctg
gtcttcgccttcaaggtgaagtttcccgagaacttcttcatccttcgaggtaaccacgag
tgcgccagcatcaatcgcatctacggcttcttcgacgagtgcaagcgccgctacaacatt
cgtctctggaaggcgttcacagatacgttcaactgccttcctgtggcgtgtattatcgat
gacaagatcttctgctgccatggtggcctttcgccggagctgcagacgatggaccagatc
aagaagatcacacgcccgtgcgatgtggcggacactggtctgatctgcgacttgctgtgg
tcagacccggaggaaggtctctcggggtggggcgagaacgaccgtggcgtgtccttcact
ttcggtcaggatattgtagagaagttcttgaataagcaccagtttgagctgatttgccgc
gcgcaccaagtcgtagaggatgggtaccagtttttcgcgaagcgcaagctcatcaccatc
ttctctgcccctaactactgtaatgagttcgataacagcggcgccgtgatgaccgtggac
aacgagctcatgtgctccttccagatccttaagccgtctgtgaagaaaccgaagttctac
tcgtaa

DBGET integrated database retrieval system