KEGG   Leishmania infantum: LINJ_28_1350Help
Entry
LINJ_28_1350      CDS       T01112                                 

Definition
putative p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     LINJ_28_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28:475841..477778
Genome map
AA seq 645 aa AA seqDB search
MSFLYIVATMLFALAGYFYFQLNRQASGRYGAVSATTNSNGKKAPGVSDAAASGSNAVAK
DQQEVTVLFGSQTGTAEMFAKTLTREGTKLGVPIKVCDLDCYEAYNMECERLVILICATY
GEGEPTDTMKNFHDWMMDECRSPGEELANVKYAVFGLGDRQYKYFCEEGIVMDRRFEELG
AQRIFGLGCGDSGNGQLEEQFDEWCKDLWPAVGRALNITIKENSEEPVEPQCRVKYWEEA
EEPLAFPKTASVLEPTQRLPVWVPIIRNEELLRNAEGHSTRAIDFSISDTIISYQAGDHL
GILPCNPDELVSQYLQSLGISDEEAGRVFSLQDKKTLKNVLPARVSMRTALKWYIDLTGP
PKKSTLRAFAHCCTDPVQKEELLRILRVNQDAQKEFAKLCGKLRTMLGFLRKFNSAKVPL
SFFLELMPRIAPRYYSISSDLLATPTLVGTTVGIVDGGLCTNMLARMQVGDKVPVFVRKS
NFHLPMRHKERPVVMIGAGTGVAPFIGFIARRGVWKQKGTELGKSILFFGCRRHDEDHIF
EDYCTEALHEGVLSALVTAYSRDQAHKVYVQHRLRERGAEIWEMLESGANVYICGDARRM
AKDVEAELKRIVEVEGKMPREAATEYMNVMEKEGRYLKDVWSSTL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcctctacattgtcgccacgatgctgttcgccctggcgggctatttctacttc
cagctgaaccggcaggcttccggacgctatggcgctgtgtctgccaccaccaattccaat
ggcaagaaggcgcctggcgtgagcgacgccgctgccagcggcagtaacgcagttgcgaag
gatcagcaggaggtcactgtcctgtttggatcgcagacgggcacggccgagatgtttgcc
aagacgctgacccgcgagggtacgaagctcggcgtgcctatcaaggtgtgcgacctcgac
tgctacgaggcgtacaacatggagtgcgagcgcctggtcattctaatctgcgccacctac
ggcgagggtgagccgaccgacacaatgaagaacttccacgactggatgatggacgagtgc
cgctcgccaggggaggagctggcgaatgtcaagtacgcggtgttcggcctgggtgatcgt
cagtacaagtacttctgcgaggagggtatcgtcatggatcgccgcttcgaggagctcggg
gcgcagcgcatctttggccttggctgcggcgactcgggcaacggacagctggaggagcag
ttcgatgagtggtgcaaggacctctggcccgctgtcgggcgtgcgctgaacatcactatc
aaggagaactcggaagaacctgtggagccacagtgccgagtcaagtactgggaggaggcc
gaggaaccgctcgcgttccccaaaacggcttccgtgctggagccgacgcaacgcctgccg
gtgtgggtgcccatcatccgcaacgaagagctgctgcgcaatgccgaggggcacagcacc
cgcgccatcgatttcagcatcagcgacaccatcatctcctaccaagccggcgatcacctc
ggcatcctgccgtgcaacccggacgaacttgtctcgcagtacctgcagtccctcggcatc
tcagacgaggaggccggccgcgtcttttccctgcaggacaaaaagaccctcaagaacgtc
ctcccagctcgtgtgtcgatgcgcacggcgctcaagtggtacatcgacctcaccgggccc
ccgaagaaatcgacgttgcgtgcctttgctcattgctgcaccgaccccgtccagaaagag
gagctgctgcgcattctacgcgtgaaccaggacgcacagaaggagttcgcgaaactatgc
ggtaagctgcgcaccatgctaggcttcctgcgcaagttcaactctgccaaggtgccgctg
tcctttttcctcgagctcatgccgcgcattgcgccccgctactactctatctcctccgac
ctccttgccacgccgaccttggtggggacgacggtcggcattgtcgatggtggactgtgc
acgaacatgcttgccaggatgcaggtgggcgacaaggtgcccgtgtttgtgcgtaagtcc
aacttccacctcccgatgcggcacaaggagcggccggtggtaatgattggcgccggcacc
ggtgtggcgccattcattggtttcattgcacgccgtggggtctggaagcagaaaggtact
gaactcggcaagtctatcctcttctttggctgccgccggcatgacgaggatcacatcttc
gaggactactgcacggaggcactccacgaaggggtcctgtcggcgctggtgaccgcgtac
agtcgcgaccaagcccacaaggtgtatgtccagcaccggctgagggagcggggggcggag
atatgggaaatgttggaatctggcgcgaacgtctacatctgcggtgacgcgaggcgcatg
gccaaggacgtggaggcggagctcaagcgcattgtggaggtggagggcaagatgccgcgc
gaggctgctaccgagtacatgaacgtgatggaaaaggaggggcggtacctaaaggatgtg
tggtcatcgaccttgtag

DBGET integrated database retrieval system