KEGG   Leishmania infantum: LINJ_29_2140Help
Entry
LINJ_29_2140      CDS       T01112                                 

Definition
putative protein kinase (EC:2.7.11.1)
Organism
lif  Leishmania infantum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:complement(886885..889332)
Genome map
AA seq 815 aa AA seqDB search
MAQAAYPPSREGSYPHSRSGGPRANPMLPEQMIGSYVIRETIGRGSFGKVKKGRHVHTGE
YVAIKILNRQKLKSANMDKKIHREIEILQLFSHPNICRLYEVISTPTDMYLIMEYVEGGE
LYDYIVQKGRVRESEARYIFQQIVCAIEYCHHFRVVHRDLKPENILLGTGLQVKLIDFGL
SNITKDGEFLATSCGSPNYAAPEVISGKLYFGPEVDVWSCGVILYALLCGCLPFDEDSIP
LLFSKIKKGKYAIPSNMQTGPRELIQQILVVDPLVRLTVPQIRDNAWFNQRLPMRLSYSE
SIFSVKEDRILSVLVSETAKRLGVRDRDVRKELELGYGAAFVAYNILLDARRRREIAAEV
RELGMSGDESRGVSHVIGAQQTKFQPKATERELNMGLMLTQSPAMVVLLDEEDATRNKWA
YNRGCFVPASVATLGDPTKVSDTSLSDGSGNGGPGGSIAVGSFRITSKMCSGSLVGSGSV
GSSSYAPGSLRGAAGLTGGSSSYRRAGMQSSTGGTAASQLGANLSDQPRVGSVARKHAMY
TAEEEQFIVENNYGWRIGIMTDWRAEQALSAIYDVLRTFKMQWKVVSPFRLLARSTAETW
SVMADSTQSRNASTRRNTLSTYSVESSAPIRIGCRSGAPGSGSSDDHEDGDIAGSMQRDE
ECIHAHITRTRRAGAAARSFGSAPGGGFNTSSSQVARGNYFGGLQGGDEEAAIVSGSAAS
GVLQSAHAIESGSESTSSPRDPRGASPPASAAASTSAIAEPASSPANPVVISLYFFRIHE
RHDKGYLVDFKVVRNAMVAADLVLLLSDTLVRKLG
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggccgcgtacccaccgtcacgagagggcagctacccacactctcgtagcggt
ggtccccgcgcgaacccgatgctgcccgagcagatgatcggcagctacgtcattcgcgag
accatcggccgcggtagctttggcaaggtgaagaaagggcgacacgtgcacactggagag
tatgtcgccatcaagatcctcaaccgccaaaaactcaagtccgccaacatggacaagaag
attcaccgcgagatcgaaattctgcagctgttctctcacccgaacatctgccgtctctac
gaggtcatctccacacctacggacatgtaccttattatggagtacgtggaaggcggagag
ctgtacgactacattgtccagaagggccgcgtgcgggaaagtgaggcgcgttacatcttc
cagcagattgtgtgcgcgatcgagtactgccaccacttccgcgtcgtgcatcgtgaccta
aagccagagaacattctgctgggaactgggctgcaggtaaagctgatcgactttggtctt
tcgaacatcacgaaggatggcgagttcctcgcgacgtcgtgcgggtcgcccaactacgcc
gcaccggaggtcatttcaggtaaactgtactttggtccagaggtggatgtatggtcttgt
ggcgtcattctctacgcgctgctctgcgggtgcctgccgttcgacgaggatagcatcccg
ctccttttcagcaagatcaagaagggcaagtatgccatcccatccaacatgcagacgggg
ccgcgggagctcattcagcagatcctcgtcgtggacccactcgtgcggctcaccgtcccg
caaatccgcgacaacgcctggttcaatcaacgcctgccaatgcggctgtcttacagtgag
tccatcttcagcgtgaaggaagaccgcattttatcggtgttggtgagcgaaacagcgaag
cggctgggagtgcgggacagagatgtgcgcaaggagctcgagctcggctacggggccgcc
tttgtcgcctataatattctgttggacgcacgccgccgtcgcgagattgcggctgaagtg
cgcgagcttggcatgtccggcgatgagtcccgcggggtgagccacgtcatcggcgcccag
cagacgaagtttcagccaaaggcgacagagcgggagctcaacatgggcctcatgctgacg
cagagccccgcgatggtggtgctgcttgacgaagaagacgccacgaggaacaagtgggcc
tacaaccgcggctgcttcgtgcccgcttccgtcgcaacccttggcgacccaacaaaggtg
agcgatacgagcctgagcgatggcagcggcaatggcggtccaggcgggtcgatcgcagtc
ggctccttccgtatcacttccaagatgtgctccggatccctggtcggctccggcagcgta
ggctcttcctcttatgcgccaggcagtctgcgcggcgcggcggggctcacgggcggcagc
agcagctaccggcgtgctggcatgcagagcagcacagggggaaccgccgcctcgcagctg
ggggcgaacctgagcgaccagccgcgcgtcggatctgtagcccgcaagcacgccatgtac
accgcggaggaggagcagttcattgtggagaacaactacggctggcgcatcggtatcatg
acggactggcgggcagagcaggcgctttccgccatctatgacgtcctgcgtaccttcaag
atgcagtggaaggtggtctcgcccttccgcctcttggcacggtcaacagccgagacatgg
agtgtgatggcggactcgacgcagagccgcaacgcgtccacacgccgaaacacgctaagc
acttactccgttgaatcctctgcaccgatccggattggctgccgcagcggtgccccaggg
agcggcagcagtgacgatcacgaggacggagacatcgccggtagcatgcaacgcgacgag
gagtgcatccacgcacatataacccgcacacgccgggcaggcgctgcggctcgcagcttc
gggagcgcaccaggtggcggcttcaacactagctcgagccaggtcgcgcgcggcaactat
ttcggcggcctacagggcggagacgaggaagcggcgatagtctctggaagcgcggcgtcg
ggagtgctgcagtcagcacatgcgattgagagcgggtctgagtcgacgtcctcgccgcgt
gacccacgcggcgcgtccccaccagcgagcgccgctgcctccacctccgcaattgcggaa
ccagcctcgtcaccggcaaatcctgtcgttatttccctctacttctttcgcattcacgag
cggcacgataaaggttacctggtggatttcaaggtcgtgcgcaatgccatggtcgccgcg
gacctggtgcttctcctctctgatacgctggtcaggaagttgggctaa

DBGET integrated database retrieval system