KEGG   Leishmania infantum: LINJ_29_2140Help
Entry
LINJ_29_2140      CDS       T01112                                 

Definition
putative protein kinase (EC:2.7.11.1)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
lif  Leishmania infantum
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:lif00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    LINJ_29_2140
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     LINJ_29_2140
Protein kinases [BR:lif01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   LINJ_29_2140
Mitochondrial biogenesis [BR:lif03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    LINJ_29_2140
  Mitophagy factors
   Other mitophagy factors
    LINJ_29_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:complement(886885..889332)
Genome map
AA seq 815 aa AA seqDB search
MAQAAYPPSREGSYPHSRSGGPRANPMLPEQMIGSYVIRETIGRGSFGKVKKGRHVHTGE
YVAIKILNRQKLKSANMDKKIHREIEILQLFSHPNICRLYEVISTPTDMYLIMEYVEGGE
LYDYIVQKGRVRESEARYIFQQIVCAIEYCHHFRVVHRDLKPENILLGTGLQVKLIDFGL
SNITKDGEFLATSCGSPNYAAPEVISGKLYFGPEVDVWSCGVILYALLCGCLPFDEDSIP
LLFSKIKKGKYAIPSNMQTGPRELIQQILVVDPLVRLTVPQIRDNAWFNQRLPMRLSYSE
SIFSVKEDRILSVLVSETAKRLGVRDRDVRKELELGYGAAFVAYNILLDARRRREIAAEV
RELGMSGDESRGVSHVIGAQQTKFQPKATERELNMGLMLTQSPAMVVLLDEEDATRNKWA
YNRGCFVPASVATLGDPTKVSDTSLSDGSGNGGPGGSIAVGSFRITSKMCSGSLVGSGSV
GSSSYAPGSLRGAAGLTGGSSSYRRAGMQSSTGGTAASQLGANLSDQPRVGSVARKHAMY
TAEEEQFIVENNYGWRIGIMTDWRAEQALSAIYDVLRTFKMQWKVVSPFRLLARSTAETW
SVMADSTQSRNASTRRNTLSTYSVESSAPIRIGCRSGAPGSGSSDDHEDGDIAGSMQRDE
ECIHAHITRTRRAGAAARSFGSAPGGGFNTSSSQVARGNYFGGLQGGDEEAAIVSGSAAS
GVLQSAHAIESGSESTSSPRDPRGASPPASAAASTSAIAEPASSPANPVVISLYFFRIHE
RHDKGYLVDFKVVRNAMVAADLVLLLSDTLVRKLG
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggccgcgtacccaccgtcacgagagggcagctacccacactctcgtagcggt
ggtccccgcgcgaacccgatgctgcccgagcagatgatcggcagctacgtcattcgcgag
accatcggccgcggtagctttggcaaggtgaagaaagggcgacacgtgcacactggagag
tatgtcgccatcaagatcctcaaccgccaaaaactcaagtccgccaacatggacaagaag
attcaccgcgagatcgaaattctgcagctgttctctcacccgaacatctgccgtctctac
gaggtcatctccacacctacggacatgtaccttattatggagtacgtggaaggcggagag
ctgtacgactacattgtccagaagggccgcgtgcgggaaagtgaggcgcgttacatcttc
cagcagattgtgtgcgcgatcgagtactgccaccacttccgcgtcgtgcatcgtgaccta
aagccagagaacattctgctgggaactgggctgcaggtaaagctgatcgactttggtctt
tcgaacatcacgaaggatggcgagttcctcgcgacgtcgtgcgggtcgcccaactacgcc
gcaccggaggtcatttcaggtaaactgtactttggtccagaggtggatgtatggtcttgt
ggcgtcattctctacgcgctgctctgcgggtgcctgccgttcgacgaggatagcatcccg
ctccttttcagcaagatcaagaagggcaagtatgccatcccatccaacatgcagacgggg
ccgcgggagctcattcagcagatcctcgtcgtggacccactcgtgcggctcaccgtcccg
caaatccgcgacaacgcctggttcaatcaacgcctgccaatgcggctgtcttacagtgag
tccatcttcagcgtgaaggaagaccgcattttatcggtgttggtgagcgaaacagcgaag
cggctgggagtgcgggacagagatgtgcgcaaggagctcgagctcggctacggggccgcc
tttgtcgcctataatattctgttggacgcacgccgccgtcgcgagattgcggctgaagtg
cgcgagcttggcatgtccggcgatgagtcccgcggggtgagccacgtcatcggcgcccag
cagacgaagtttcagccaaaggcgacagagcgggagctcaacatgggcctcatgctgacg
cagagccccgcgatggtggtgctgcttgacgaagaagacgccacgaggaacaagtgggcc
tacaaccgcggctgcttcgtgcccgcttccgtcgcaacccttggcgacccaacaaaggtg
agcgatacgagcctgagcgatggcagcggcaatggcggtccaggcgggtcgatcgcagtc
ggctccttccgtatcacttccaagatgtgctccggatccctggtcggctccggcagcgta
ggctcttcctcttatgcgccaggcagtctgcgcggcgcggcggggctcacgggcggcagc
agcagctaccggcgtgctggcatgcagagcagcacagggggaaccgccgcctcgcagctg
ggggcgaacctgagcgaccagccgcgcgtcggatctgtagcccgcaagcacgccatgtac
accgcggaggaggagcagttcattgtggagaacaactacggctggcgcatcggtatcatg
acggactggcgggcagagcaggcgctttccgccatctatgacgtcctgcgtaccttcaag
atgcagtggaaggtggtctcgcccttccgcctcttggcacggtcaacagccgagacatgg
agtgtgatggcggactcgacgcagagccgcaacgcgtccacacgccgaaacacgctaagc
acttactccgttgaatcctctgcaccgatccggattggctgccgcagcggtgccccaggg
agcggcagcagtgacgatcacgaggacggagacatcgccggtagcatgcaacgcgacgag
gagtgcatccacgcacatataacccgcacacgccgggcaggcgctgcggctcgcagcttc
gggagcgcaccaggtggcggcttcaacactagctcgagccaggtcgcgcgcggcaactat
ttcggcggcctacagggcggagacgaggaagcggcgatagtctctggaagcgcggcgtcg
ggagtgctgcagtcagcacatgcgattgagagcgggtctgagtcgacgtcctcgccgcgt
gacccacgcggcgcgtccccaccagcgagcgccgctgcctccacctccgcaattgcggaa
ccagcctcgtcaccggcaaatcctgtcgttatttccctctacttctttcgcattcacgag
cggcacgataaaggttacctggtggatttcaaggtcgtgcgcaatgccatggtcgccgcg
gacctggtgcttctcctctctgatacgctggtcaggaagttgggctaa

DBGET integrated database retrieval system