KEGG   Leishmania infantum: LINJ_29_2410Help
Entry
LINJ_29_2410      CDS       T01112                                 

Definition
putative cysteine peptidase, Clan CA, family C19 (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
lif  Leishmania infantum
Brite
Enzymes [BR:lif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     LINJ_29_2410
Peptidases [BR:lif01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   LINJ_29_2410
Exosome [BR:lif04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LINJ_29_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:complement(1026527..1028773)
Genome map
AA seq 748 aa AA seqDB search
MPFPVTQEACPHAWSDSAIVTPFPGKTVHRDECAYCCRTCRQGDGVYVCMACHTGLCCEH
LEKHMRVHGAHAIYTTVKKLPAKETDEVKDVNYLGVVAPAEYETAVCCADCQVRFAQVPD
LAVEAYSGIINAPEPGAQDSAADGGVGRLQKPQCPHLVCLEQLASPFAVCPPTSDDICSV
EMCGCNVNNWMCVTCGAIGCPRPEAGGQGHALQHYELTGHPACVKLGTITAEGADYYCYG
CDDDVDDVHFAAHMAHFGIDVQTAKKTAKTMGELEYDYSSQFDFNKITEAGVSLTPSYGP
GHTGIENIGNSCYLASVVQCLMSLGPFQRFFFPAKSTPHQAQCTANPYNCHHCQTERVAA
GLLSGEFSREGHELTNGICPRLFKKVYAHQHPEFSTGAQQDAQEYLLYLLEEMQRHVHLN
SSGSTSADNVQQQIHPSDIMEMVIEQRMQCSKCQRVRYTYETDKCLSLPIPIDPVPASSV
AAAASEAEMDAIRPRCSLEDCLQAATSPSGIECRCEACLESAVYYTVTRLASFPDVLPVY
IRRTYFDMTTHNTKKMDAYVEVPQKLVLEAYRGTGLQPGEVLMPASSASSARQPRLDAHV
AAPQQEVDEVALVSVVSMGIEMDVARYALLQTNMNVERAIDYIFSHPHIADEIKAAPPLH
AEEQEQHLAPTQSATSVSAPKPATDGAASYELTAMISHMGASARTGHYVCHIKDAATGKW
LLFNDEKVGESQNPPFSLASLYFFQRQA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgccgttccctgtgacgcaggaggcgtgtcctcacgcgtggagtgactctgccatagtg
accccgttccccggaaagacagtgcaccgtgacgagtgtgcgtactgctgccggacatgc
cgtcaaggcgacggagtctatgtatgtatggcatgccacacaggtctgtgctgcgagcac
ctggagaagcacatgagggtgcacggggcgcacgccatatacacaaccgtcaagaaactc
cccgcaaaggaaacggatgaggtgaaggatgtgaattaccttggtgtagtggcccccgcg
gagtatgagacggcggtgtgctgcgcggattgccaggtgcggtttgcgcaagtaccggac
ctggctgtcgaggcgtacagcggcatcatcaacgcgccggaaccaggcgcgcaggatagc
gcagctgatggcggtgtgggccgcctgcagaagccgcaatgccctcatctggtgtgcctc
gaacagctggcgagcccctttgctgtttgtccgcccacttccgacgacatctgctccgtg
gagatgtgcggatgcaacgtgaacaactggatgtgcgtcacgtgcggtgcaatcggttgc
cctcgtcccgaagcaggcggccagggccatgcactacagcactatgagctgacaggacac
cctgcgtgtgtcaagcttggcaccatcaccgcggagggcgccgactactattgctacggc
tgcgacgatgacgttgatgacgtacacttcgcagcccacatggcacactttggcattgac
gtacaaactgccaagaagactgccaagacgatgggcgagctcgagtacgactactcctcg
cagtttgacttcaacaagatcacggaggccggcgtgtccttgacgccatcctacggtcca
ggccacactggcatcgagaatattggcaacagctgctacctcgcatccgttgtgcagtgc
cttatgtcgctgggcccgttccagcgcttcttctttccggccaagtcgaccccgcatcag
gcacagtgcaccgcgaatccgtacaactgccaccactgccagacggagcgcgtggcggcc
ggcttgctctccggtgagttcagccgggaaggccacgagctcaccaacggcatctgcccc
cgcctcttcaagaaggtgtacgcccaccagcaccctgagttctccactggcgcccagcag
gatgctcaggagtacctgctctacctgctggaagagatgcagcggcacgtgcacctcaac
agcagcggcagcaccagtgccgacaatgtgcagcagcagattcacccgtctgatatcatg
gagatggtgattgagcagcgtatgcagtgcagcaagtgccagcgagtgcgctacacgtat
gagacggacaaatgcctgtccttgccgatcccgatcgatccggtgccggcctcgtctgtt
gcagctgctgcaagcgaggcggagatggacgcgatacggcctcggtgctcgctggaggac
tgcctgcaagcagccacctcgccgagcggcatcgagtgccggtgcgaggcatgccttgaa
tcggccgtgtactacaccgtcacccgcctcgccagcttcccagatgttctgccagtgtac
attcgccgcacgtacttcgacatgactacccacaacacaaagaaaatggatgcatatgtg
gaggtgccgcagaagctcgttctggaggcttaccgcggcactgggctgcagccgggtgag
gtgctgatgcctgcttcgtcggcctcctctgcacgacagcctaggctagatgcccacgtg
gccgctccgcagcaggaagtagatgaggtggcactggtgtcggtggttagcatggggatc
gagatggacgtcgcgcgctacgccctcttacagacgaacatgaacgttgagcgcgccatc
gactacatattcagccatccgcacatcgctgacgagatcaaggccgcgccaccgctgcac
gccgaggagcaggagcagcatttggcgccaacccaaagcgctacttcagtgagcgctcca
aaaccggctaccgatggggccgcctcatacgagctcacagcgatgatcagtcacatgggc
gcgagtgcacggacggggcattacgtttgccacatcaaggatgccgcgacgggcaagtgg
ctcctattcaatgatgaaaaggtgggtgagtcgcagaacccgcccttctccctggcgtcg
ctgtactttttccaacgccaggcctaa

DBGET integrated database retrieval system