KEGG   Leishmania infantum: LINJ_29_2620Help
Entry
LINJ_29_2620      CDS       T01112                                 

Definition
ATP-dependent phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lif  Leishmania infantum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LINJ_29_2620
   01230 Biosynthesis of amino acids
    LINJ_29_2620
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LINJ_29_2620
   00030 Pentose phosphate pathway
    LINJ_29_2620
   00051 Fructose and mannose metabolism
    LINJ_29_2620
   00052 Galactose metabolism
    LINJ_29_2620
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LINJ_29_2620
Protein phosphatases and associated proteins [BR:lif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LINJ_29_2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:1094688..1096148
Genome map
AA seq 486 aa AA seqDB search
METRHHLNTKMVPSYQAPLSKVTAADLTVERLPGCKYMNPSKKHILREEYRDKVEHIMYD
PRPQEDLDAEYPVSCNKLVCELAAARKHLHFNPSETSIGIVTCGGICPGLNDVIRSITLT
GIISYRVKRVVGFRYGYWGLSKEGSKTAIELSRSDVRQIHRFGGTILGSSRGPQNPKEMV
DTLVRMKINILFTVGGDGTQRGALTIYEEAKRRGENIAVFGVPKTIDNDLAFSHRTFGFQ
TAVEQAVNAVRAAYAEAVSLNYGVGIVKLMGRESGFIAAQTTVASAQANICLIPENPLPK
ETVMRLIERRLQQSRNCVIVVAEGFGQDWETGTGGHDASGNKKLVDIGFILKKEVESWLR
ANKEKFPQGTVKYIDPSYMIRACPPSSNDALFCTNLATLAVHEAMAGATGCIISMRYNNY
ILVPIKAATSVRRVVSLRGALWRQVREITVGLSDDVQQWNEQDLRRHLESLNVERERIIA
RLASKV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggagactcgccaccatctcaacaccaagatggtgccgtcgtaccaggcaccgctgtcc
aaggtgaccgccgccgacctgacggtggagcgcctgcccggctgcaagtacatgaacccc
tcaaagaagcacattctccgtgaggagtaccgcgacaaggtggagcacatcatgtacgac
cctcgcccgcaggaggacctggacgccgagtacccggtgtcgtgcaacaagctggtgtgc
gaactggctgccgcccgcaagcacctccacttcaacccttccgagacctccatcggtatt
gtaacctgcggcggcatctgccctggtctgaacgacgtcatccgctccatcacgctgacg
ggcatcatatcctaccgcgtcaagcgcgttgtcggtttccgttacggctactggggcctg
tcgaaggagggcagcaagactgccatagagctgtcccgctcggatgtgcgccagattcac
cgcttcggcggcacgatcctgggtagctctcgcggtccgcagaacccgaaggagatggtc
gacacgcttgtgcgcatgaagatcaacatcctcttcaccgttggtggtgatggcacgcag
cgcggtgcgctaacgatctacgaggaggccaagcgccggggcgagaacatcgccgtcttc
ggtgtgcccaagacgatcgataacgaccttgccttctcccaccgcacctttggctttcag
actgccgtcgagcaagctgtgaacgccgtgcgcgccgcctacgccgaggctgtgtccctc
aactacggtgtcggcatcgtgaagctgatgggtcgtgagagcggcttcattgctgcccag
acgactgtggccagcgcgcaggcgaacatctgcctcattcctgagaacccgttgccaaag
gagacggtgatgcgcctgattgagcgccgccttcagcagtcgcgcaactgcgtcatcgtg
gttgccgagggcttcggccaggactgggagaccggcacgggcggccatgacgcctccggt
aacaagaagctcgtcgacattggcttcatcctgaagaaggaggtggagagctggctgcga
gcaaacaaggagaagttcccgcagggtactgtcaaatatatcgacccctcgtacatgatc
cgcgcctgcccgccgtcttccaacgacgcgctcttctgcaccaacctggcaactcttgcc
gtgcacgaggccatggccggtgccaccggctgcatcatctcaatgcgctacaacaactat
atcctcgtgcccatcaaggcggccacgtcggtgcgccgggtcgttagtctccgtggcgcc
ctctggcgccaggtgcgtgagatcaccgtgggcctgagcgacgatgtgcagcagtggaac
gagcaggacctgcgccgccacctggagtcgctgaatgttgagcgcgagcgcataattgcg
cgcctggcgtctaaggtgtaa

DBGET integrated database retrieval system