KEGG   Leishmania infantum: LINJ_29_2620Help
Entry
LINJ_29_2620      CDS       T01112                                 

Definition
ATP-dependent phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lif  Leishmania infantum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:lif01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lif01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lif00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lif00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lif00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lif00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29:1094688..1096148
Genome map
AA seq 486 aa AA seqDB search
METRHHLNTKMVPSYQAPLSKVTAADLTVERLPGCKYMNPSKKHILREEYRDKVEHIMYD
PRPQEDLDAEYPVSCNKLVCELAAARKHLHFNPSETSIGIVTCGGICPGLNDVIRSITLT
GIISYRVKRVVGFRYGYWGLSKEGSKTAIELSRSDVRQIHRFGGTILGSSRGPQNPKEMV
DTLVRMKINILFTVGGDGTQRGALTIYEEAKRRGENIAVFGVPKTIDNDLAFSHRTFGFQ
TAVEQAVNAVRAAYAEAVSLNYGVGIVKLMGRESGFIAAQTTVASAQANICLIPENPLPK
ETVMRLIERRLQQSRNCVIVVAEGFGQDWETGTGGHDASGNKKLVDIGFILKKEVESWLR
ANKEKFPQGTVKYIDPSYMIRACPPSSNDALFCTNLATLAVHEAMAGATGCIISMRYNNY
ILVPIKAATSVRRVVSLRGALWRQVREITVGLSDDVQQWNEQDLRRHLESLNVERERIIA
RLASKV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggagactcgccaccatctcaacaccaagatggtgccgtcgtaccaggcaccgctgtcc
aaggtgaccgccgccgacctgacggtggagcgcctgcccggctgcaagtacatgaacccc
tcaaagaagcacattctccgtgaggagtaccgcgacaaggtggagcacatcatgtacgac
cctcgcccgcaggaggacctggacgccgagtacccggtgtcgtgcaacaagctggtgtgc
gaactggctgccgcccgcaagcacctccacttcaacccttccgagacctccatcggtatt
gtaacctgcggcggcatctgccctggtctgaacgacgtcatccgctccatcacgctgacg
ggcatcatatcctaccgcgtcaagcgcgttgtcggtttccgttacggctactggggcctg
tcgaaggagggcagcaagactgccatagagctgtcccgctcggatgtgcgccagattcac
cgcttcggcggcacgatcctgggtagctctcgcggtccgcagaacccgaaggagatggtc
gacacgcttgtgcgcatgaagatcaacatcctcttcaccgttggtggtgatggcacgcag
cgcggtgcgctaacgatctacgaggaggccaagcgccggggcgagaacatcgccgtcttc
ggtgtgcccaagacgatcgataacgaccttgccttctcccaccgcacctttggctttcag
actgccgtcgagcaagctgtgaacgccgtgcgcgccgcctacgccgaggctgtgtccctc
aactacggtgtcggcatcgtgaagctgatgggtcgtgagagcggcttcattgctgcccag
acgactgtggccagcgcgcaggcgaacatctgcctcattcctgagaacccgttgccaaag
gagacggtgatgcgcctgattgagcgccgccttcagcagtcgcgcaactgcgtcatcgtg
gttgccgagggcttcggccaggactgggagaccggcacgggcggccatgacgcctccggt
aacaagaagctcgtcgacattggcttcatcctgaagaaggaggtggagagctggctgcga
gcaaacaaggagaagttcccgcagggtactgtcaaatatatcgacccctcgtacatgatc
cgcgcctgcccgccgtcttccaacgacgcgctcttctgcaccaacctggcaactcttgcc
gtgcacgaggccatggccggtgccaccggctgcatcatctcaatgcgctacaacaactat
atcctcgtgcccatcaaggcggccacgtcggtgcgccgggtcgttagtctccgtggcgcc
ctctggcgccaggtgcgtgagatcaccgtgggcctgagcgacgatgtgcagcagtggaac
gagcaggacctgcgccgccacctggagtcgctgaatgttgagcgcgagcgcataattgcg
cgcctggcgtctaaggtgtaa

DBGET integrated database retrieval system