KEGG   Leishmania infantum: LINJ_30_0370Help
Entry
LINJ_30_0370      CDS       T01112                                 

Gene name
MPK12
Definition
putative mitogen-activated protein kinase (EC:2.7.11.1)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lif  Leishmania infantum
Pathway
Leishmaniasis
Class
Human Diseases; Infectious diseases; Leishmaniasis [PATH:lif05140]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30:complement(119997..121229)
Genome map
AA seq 410 aa AA seqDB search
MILTKVEGPNAAGNKVYVFGVNDYRLEVPERYNVQHFVGRGAYGFVCSAVDAVTNEPVAI
KKVTHLFDDAVDAKRVLREVKLLAYLKHPNILSLKDLFKSPDPVDTYSELYVVTDLMESD
MDAILRSPRIRLAAGHGQYFTLQLLCALQYIHSAHVLHRDLKPGNLLTDSECNLKLGDFG
LARGIGHDDTMTQYVFTRWYRPPELLLVCKHCNYSADMWAVGCLAAEMFTGKPLFPGKDY
INQINLIVELLGIPDLARDLPPSTSTEAIHYLSSLPPSKGKKLEEYAPELRRRFDETTFY
DSFDTELEEAIAAEGATIARPQPRPPEEYYAEFVDFIFGLLRYNPEKRRTAKESIAHAWL
SDVRGPQETIGGCEAERIYRWDADGTAFTIPQLRHLFIDEIGKFASTRGS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatactcaccaaggtagagggccctaacgcggctggcaacaaggtttacgtctttggt
gtgaacgactaccgccttgaggtcccagagcgctacaacgttcagcactttgtggggcgt
ggcgcttacggctttgtgtgcagcgccgtggacgcggtgacgaacgagccggtggcgatt
aagaaggtgacgcacctcttcgacgatgccgtcgatgcaaagcgcgtcttgcgggaggtg
aagctgttagcctatctcaagcaccccaacatcctctccctcaaggatctcttcaagtca
ccggacccggtcgacacgtacagcgagctctacgttgtgaccgacttgatggagtcggac
atggacgccatcctgcgctccccacgcatccgtctcgccgccgggcacgggcagtacttc
acccttcagctgctgtgcgcactgcaatacattcacagcgctcatgtgctgcaccgagac
ctgaagccggggaacctgctgacagactcggagtgcaaccttaagctgggcgacttcggc
ctcgcgcggggtatcgggcatgacgacaccatgacacagtatgtgttcacgcggtggtac
cggccaccagagttgctgctggtgtgcaagcactgcaactacagcgcggacatgtgggct
gttggatgccttgcggcagagatgttcaccggcaagccgctcttccctggcaaagactac
atcaaccagatcaatctcatagtggagttgctgggcataccggacctggcacgtgacctg
ccgccgagcacgtcaacggaggcgatacactacctctcctccctgccccctagcaagggg
aagaagctcgaggagtacgccccggagctgcggcgtcgctttgacgagaccaccttttat
gacagcttcgacacggagctagaggaggcgatcgctgcggagggcgccaccatcgcccgc
cctcagccacgcccgccggaggagtactacgccgagttcgtcgacttcatctttggacta
cttcgttacaaccccgagaagcggcgcacagcgaaggagtccatagcgcatgcgtggctg
tcggacgtgcgcggcccacaggagaccattggcggctgcgaggcggagcgaatataccgc
tgggatgccgacggcaccgccttcaccatcccacaacttcgccatctctttatagatgag
atcggaaagtttgcgtctacccggggcagctga

DBGET integrated database retrieval system