KEGG   Leishmania infantum: LINJ_30_0370Help
Entry
LINJ_30_0370      CDS       T01112                                 

Gene name
MPK12
Definition
putative mitogen-activated protein kinase (EC:2.7.11.1)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lif  Leishmania infantum
Pathway
Leishmaniasis
Brite
KEGG Orthology (KO) [BR:lif00001]
 Human Diseases
  Infectious diseases
   05140 Leishmaniasis
    LINJ_30_0370 (MPK12)
Enzymes [BR:lif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     LINJ_30_0370 (MPK12)
Protein kinases [BR:lif01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   LINJ_30_0370 (MPK12)
Exosome [BR:lif04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LINJ_30_0370 (MPK12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30:complement(119997..121229)
Genome map
AA seq 410 aa AA seqDB search
MILTKVEGPNAAGNKVYVFGVNDYRLEVPERYNVQHFVGRGAYGFVCSAVDAVTNEPVAI
KKVTHLFDDAVDAKRVLREVKLLAYLKHPNILSLKDLFKSPDPVDTYSELYVVTDLMESD
MDAILRSPRIRLAAGHGQYFTLQLLCALQYIHSAHVLHRDLKPGNLLTDSECNLKLGDFG
LARGIGHDDTMTQYVFTRWYRPPELLLVCKHCNYSADMWAVGCLAAEMFTGKPLFPGKDY
INQINLIVELLGIPDLARDLPPSTSTEAIHYLSSLPPSKGKKLEEYAPELRRRFDETTFY
DSFDTELEEAIAAEGATIARPQPRPPEEYYAEFVDFIFGLLRYNPEKRRTAKESIAHAWL
SDVRGPQETIGGCEAERIYRWDADGTAFTIPQLRHLFIDEIGKFASTRGS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgatactcaccaaggtagagggccctaacgcggctggcaacaaggtttacgtctttggt
gtgaacgactaccgccttgaggtcccagagcgctacaacgttcagcactttgtggggcgt
ggcgcttacggctttgtgtgcagcgccgtggacgcggtgacgaacgagccggtggcgatt
aagaaggtgacgcacctcttcgacgatgccgtcgatgcaaagcgcgtcttgcgggaggtg
aagctgttagcctatctcaagcaccccaacatcctctccctcaaggatctcttcaagtca
ccggacccggtcgacacgtacagcgagctctacgttgtgaccgacttgatggagtcggac
atggacgccatcctgcgctccccacgcatccgtctcgccgccgggcacgggcagtacttc
acccttcagctgctgtgcgcactgcaatacattcacagcgctcatgtgctgcaccgagac
ctgaagccggggaacctgctgacagactcggagtgcaaccttaagctgggcgacttcggc
ctcgcgcggggtatcgggcatgacgacaccatgacacagtatgtgttcacgcggtggtac
cggccaccagagttgctgctggtgtgcaagcactgcaactacagcgcggacatgtgggct
gttggatgccttgcggcagagatgttcaccggcaagccgctcttccctggcaaagactac
atcaaccagatcaatctcatagtggagttgctgggcataccggacctggcacgtgacctg
ccgccgagcacgtcaacggaggcgatacactacctctcctccctgccccctagcaagggg
aagaagctcgaggagtacgccccggagctgcggcgtcgctttgacgagaccaccttttat
gacagcttcgacacggagctagaggaggcgatcgctgcggagggcgccaccatcgcccgc
cctcagccacgcccgccggaggagtactacgccgagttcgtcgacttcatctttggacta
cttcgttacaaccccgagaagcggcgcacagcgaaggagtccatagcgcatgcgtggctg
tcggacgtgcgcggcccacaggagaccattggcggctgcgaggcggagcgaatataccgc
tgggatgccgacggcaccgccttcaccatcccacaacttcgccatctctttatagatgag
atcggaaagtttgcgtctacccggggcagctga

DBGET integrated database retrieval system