KEGG   Leishmania infantum: LINJ_31_0150Help
Entry
LINJ_31_0150      CDS       T01112                                 

Definition
putative cysteine peptidase, Clan CA, family C19 (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
lif  Leishmania infantum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31:complement(38907..40283)
Genome map
AA seq 458 aa AA seqDB search
MAEIKVKWGKENLTMEVDLGSTVGAFKEALKAKTGVPVEKQKLMGLKPSMNKDDATLSAA
GLVTGKTVMLIGSAESTAAVPTVQAAVVEANETGGYTATATTSNGLKNIANTCYLNSALQ
MMRSIPEIREVLEAYRGDNALLQQLAAVLQLLESTKDAVMPLQFWTTLVQTNPTFGERNE
HGGFMQQDSQEVLNMLLQAVNSVLPEKYAHLFEGKLHQTLTCVDDPADKGKESDVPFTML
SCNITGEVQTLEAGLEHAFDERFTAPCEALQKDVAQFTRVSKLTEAPEYVFVHMVRFSWR
GDIQKKAKILKPITFPFILDTTIISTEALKAAQKPVREGIRERRDKELERRRRPRTEEKP
SPVDKPQEEEKVPLALKNESGYYDLCGVISHKGRSADGGHYVYWGKKADKWLVYDDEHVA
AVSEEDVKRLRGVGEAHIAYVLLYRSRDPVTRTPVIPL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaagtcaagtggggtaaggagaacctcacgatggaggtggacctggga
agtacggtgggtgccttcaaggaggccctcaaagccaagaccggggtgccagtggagaag
cagaagctcatgggcctaaagccctccatgaacaaggatgacgctacgctcagcgccgcc
ggcctcgtgacaggcaagacggtgatgctgattgggtcagcggagagcactgcagcggtg
cccacggtgcaagcggctgttgtagaagcaaatgagacaggtggctacaccgcgactgcg
acaacctcaaatggcttaaagaatattgccaacacgtgctacctgaactcggctctgcag
atgatgcggagtattccggagattcgggaagtgctcgaggcgtaccgcggcgacaacgca
cttctgcagcagctcgctgccgtgctgcagttgctggagagcaccaaggatgctgtgatg
ccgctacagttctggacgacgctcgtgcagacaaatccaacgtttggtgagcgcaacgag
cacggcggcttcatgcagcaggactcgcaggaggtgctgaacatgctgctccaggccgta
aactccgtgctgcccgagaagtacgcgcacctcttcgaaggcaagctgcaccagaccctc
acctgcgtcgacgacccggctgacaagggcaaggagtccgacgtgcccttcacgatgctc
tcctgcaatatcactggagaggtgcagacgctcgaggcggggctcgagcacgccttcgac
gagcgcttcaccgcaccttgcgaggccctgcagaaagacgtcgcccagttcactcgcgtt
agcaaactgaccgaagcaccggaatatgtctttgtgcacatggtgcgcttctcctggcgc
ggcgacattcaaaagaaggctaagatcctcaagcctatcacgttccccttcattctcgac
accaccatcatctccaccgaagcgctcaaggcggcacagaagccggtgcgcgagggtatc
cgcgagcggcgcgacaaggagctggagcggcgccgccgcccccgcacagaggagaagccg
tcgccagtggacaaaccgcaggaggaggagaaggtgcccctggccctcaagaatgagagc
ggctactatgacctgtgcggcgtcatctcgcacaagggccgcagcgcggacggcggccac
tacgtctactggggtaagaaagcagacaagtggctcgtctacgacgacgagcacgtggcg
gccgtctcggaggaggacgtgaagcggctgcgtggtgtcggagaagctcacatcgcctac
gtcctgctgtatcgcagtcgcgaccccgtcacacgaactccggttattccactttag

DBGET integrated database retrieval system