KEGG   Leishmania infantum: LINJ_31_3080Help
Entry
LINJ_31_3080      CDS       T01112                                 

Definition
putative acetyl-CoA carboxylase (EC:6.4.1.2)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
lif  Leishmania infantum
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lif00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LINJ_31_3080
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LINJ_31_3080
   00640 Propanoate metabolism
    LINJ_31_3080
  Lipid metabolism
   00061 Fatty acid biosynthesis
    LINJ_31_3080
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    LINJ_31_3080
Enzymes [BR:lif01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     LINJ_31_3080
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     LINJ_31_3080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
31:complement(1378813..1385319)
Genome map
AA seq 2168 aa AA seqDB search
MEAMQEKSSPVGFRYDSMEQLCSSLGAIMPIKRLLIANNGLAAVKGMDSIRSWMYEHTGD
SDAVQFVVMATPEDLKANAEFISLADKHIPVPGGMNSNNYANVDVIMQTALQNMCDAIYP
GWGHASENPALPRECMKSKRVTFLGPSEDAMFALGDKIASTIVAQSNGVPTVPWSGDSIR
LPPKTFSVDAAAYEKAYVNSPEECEEVCRRIGFPVMIKASEGGGGKGIRSCKCLKDVKSL
FFAVSEEVKGCHIFVMRMLENVRHLEVQLLADCYGNCIAVRTRDCSVQRRHQKIIEEGPA
FGVDPAIITAMERAAIQLACAVKYCGLGTVEYMYDKETHKFYFLELNPRIQVEHPVSEMI
SGVNLPAALFCVGMGIPLDRIPEVRAFYGEDPYGTTPIDFSARQSVPPKCHTIAVRVTAE
DTDEGFRPTSGKVEEIAFKNSKECWGYFSVGSGGEIHQYADSQFGHIFSSGETREDARRG
MVLALRKLVVRGEIRTSTSYAMELLETSAFRDCDVSTAWLDGMIAKKAAEAPAHQRSIHS
ALIAASIYRNMRWMQEHKDKYIAFLAAGHVPSTEYLSNLHTESYVSRSEKYTLSAGMVSL
NEYAISLNGSIVLVPYRILTSGALQLTIGDKTLVAYVAEEPNSLRITIGGKVTNFSGDVD
PTKIMASVPGRLVRYVIDDDGHVNEGDAFAELEVMKMILPLRARTTGTLHHRAVPGTTIA
MGSLLAEITPDDPSKVARPKEIQDPWPTELLVARQYERPDGVTRARRAAESLWLLVNGFH
FKEIPIEERVRRAFADLASLGLSSVTLKAVHLPFIPAEICDETEARPQTPSEKYRAIIDA
IVDRYVTVEQPFDGHSRQEAIEGLRNTLNDNEAVFQIDFAHNQECHHYVMRSVLKYLESN
ALLLKSLKGTLSKLVTLKSFAYGSLLLQARYLLRMCSLPSFTERKAQFAEALEEGSLRSL
VASGFGYDLLCSIMFDRQMEHLVHICLELFIRREYSGESEIKDLDILKQGTSWYASYSFD
PIEDAEVLHMSDELAVGSRRIIGGRGICVMLPDEKLLQSTLASSFRDVVSHYSDDIVIAT
VFFSVSRESTQSDVARMCRLLMEENAAVFQKFEKLETVYFMAHGMPEGPHFFTFRAETGF
QEDTLLRNVLPQSARRLELDRLSNYEVSMHPTPYKDVHVFKAAPKKAGASALEHRMFARV
AVTPHDMGMTPWTEVTDVDVGHMLAKCLAALQVARDDSTVKFPDSNHVFVKMIELTFDVR
SLQPLLVAAASSYQEKLTELGVRDVEVSFHVKVPSGLIPMRVIAKSPSGYGVSVHVYYES
LSNGQLQLHRAETSEDVDYSSTGRSAESLLEMSLTSPMMPAPRGTPHLMRTASKLGDLRE
MLPSEKEQQISVDMMSEPTETRHRAITLGPYPQLEARDVKRLQARRAGTTYVHDWPAVLN
LILRKEWMKLRCALDLPHTSIPKNPLRATELFLCEDGELLSTRRTFAQSCGMVVWMVEYA
PPRYFDMELKTAQTRRIVVVANDITFQSGSFAVPEDCVFKAASVLARAQHVPFVYISTNS
GARLGLSTEVKKRFLVEFTEKNDIAYLYLTKSDYEELRERKKIQMEAEPLEVKGETRYVI
KGVVGGPTEYIGVENLSGSGLVAGEMSKNYSEIPTISLVSGRSVGIGAYLNRLGRRVIQT
NDSPLILTGAGALNRLLGKDVYMGNSQLGGKQIMVPNGVTHWCTHHDYGSARVLLRWLDY
VPAVLHPRRCTPHRLLWASVDPIDRDVTFCPTSNTQYDPRLLVTGLLGQTGLFDRGSWME
TLEGWARTVVVGRATLGGIPCGVILVETRLTKKFDPADPADPTSTSSFITQAGQVWFPDS
ARKTADALDDFHHERLPCFILANWRGFSGGMRDMFDEVLKFGASIVDNLRVYTAPVFIYI
PPGGELRGGAWVVVDPTINHNGVVEMYCDPSSRGGILEPSGVVEIKFRDDDVLQLIRRSR
PDLAAMEAKAAREAEKELLPHYRDVAVRFADLHDTYVRMKATGVVRDVVPWKDSRRHFYH
KLQRKLKELEVANDMLEVGVVDSLAGGVRKVEECYSVAHPNGPAWGTADQDQLKWLQGLD
GTWIGESNGHAALNNSEWAKELQRLLTLHGGEESSMERALAKLFENPAIAKAAKVALDSS
ACAHSTAE
NT seq 6507 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgatgcaggaaaagagttccccggtggggttccggtacgactccatggagcag
ctgtgtagctcgctcggggctataatgccgatcaagcgccttcttattgccaacaacgga
ctcgccgccgtgaaggggatggactcgattcgatcgtggatgtacgagcacacgggtgac
tccgatgcggttcagttcgtggtgatggccaccccagaggacctaaaggcgaacgccgaa
ttcatctcgctcgcggacaagcatattcctgttccgggcggcatgaatagcaacaactac
gcaaacgtggatgtcattatgcagacagcgctgcagaacatgtgtgacgccatctacccc
ggctggggccacgcctccgagaacccggcactgccgcgcgagtgcatgaagtcaaaacgc
gtcacctttcttggcccgtctgaagatgccatgtttgcgttgggagacaagatcgcctca
acgattgtggcgcagtccaacggtgtaccgacggttccgtggagcggcgacagcattcgc
ctccccccaaagaccttctctgtggacgccgcagcgtacgagaaggcgtacgtgaactcg
ccggaggagtgcgaggaggtgtgccgccgcatcggcttccccgtgatgatcaaggcgtct
gaaggcggtggtggcaagggtatccgcagctgcaagtgtctgaaggacgtcaagagcttg
ttcttcgctgtgtccgaggaggtgaaaggctgccacatctttgtgatgcgcatgctggag
aatgtgcgccacctggaggtgcagctgcttgccgactgctacggcaactgcatcgccgtg
cgcacgcgtgactgcagcgtgcagcggcgccaccaaaagattatcgaggagggccccgcc
ttcggggtcgatcccgccatcatcacggcaatggaaagagcggccattcagctggcctgc
gcggtgaaatactgcggtctcggcacggtggagtacatgtacgacaaggagacgcacaag
ttttactttttggagctgaacccgcgcatccaggtcgaacaccccgtctcggagatgatc
tcgggcgtgaatctgccggctgccctcttctgcgtcggcatgggcatcccgctcgaccgc
attccggaggtgcgcgccttctacggcgaggacccgtacggcaccaccccgatcgacttc
tcggcccgccagagcgtaccgccgaagtgccatacgatcgctgtgcgcgtgacggccgag
gatacggacgaaggcttccggccgacctccggcaaggtggaggagattgccttcaagaac
agcaaggagtgctggggctacttctccgtcggctccggcggtgagattcaccagtacgcc
gactcgcagtttggccacatcttttcctccggcgagacccgcgaggatgcgcgccgcggg
atggtgcttgcgctccgcaaacttgtcgtccgcggcgaaatccgcacgtcgacgtcgtac
gccatggagctgctagagacgtcggccttccgcgactgtgatgtgagcacggcttggctg
gacggcatgatcgccaagaaagcggccgaagcgccggcgcaccagcgcagcatccactcc
gcgctgatcgccgccagcatctaccgcaacatgcgctggatgcaggaacacaaggacaag
tacatcgccttcctcgccgccggccacgtgccgtccacggagtatctctccaaccttcac
accgagtcctacgtgagccgctcggagaagtacacgctgagcgccggtatggtgagcctg
aacgagtacgccatctccttgaacggcagtatcgtgctggtgccgtaccgcatcctcacg
tccggtgccctgcaactgaccatcggcgacaagacgctggtcgcctacgtcgccgaggag
ccgaacagcctgcgcatcaccatcggcggcaaagtgacgaacttctccggcgacgttgac
ccgacgaaaattatggccagcgtccccggccgcctggtgcgctacgtcatcgacgatgac
ggccacgtcaacgagggcgacgcgtttgccgagttggaggtaatgaagatgattctgccg
ctgcgggccaggactaccggtacgttgcatcaccgtgccgtgcccggcacgaccatcgcg
atgggctcgctgctggccgagatcaccccggacgacccgagcaaggtcgcgcgaccgaag
gagatccaagacccgtggccgacagagctgcttgtcgcccgtcagtacgagcggccagac
ggcgtgacgcgcgcgcgccgcgccgcggagtcgctgtggttgcttgtcaacggcttccat
ttcaaggagattccgatcgaggagcgggtgcgcagggcattcgccgacctcgcctcgctg
ggtctctcgtcggtcacgctcaaggcggtccacctgcccttcattcctgccgagatatgc
gacgagacggaggcgcgcccgcagacgccgagcgagaagtaccgcgccatcatcgacgcc
attgtggaccgctacgtcaccgtggagcagccctttgacgggcacagccggcaagaggcg
atcgaggggctgcgcaacaccctcaacgacaacgaggccgtcttccagatagactttgcg
cacaaccaggaatgccaccactacgtaatgcgcagcgtgctgaaatacctcgagagcaac
gcgctgcttctcaagtctctgaaagggacgctgtcgaagttggtcaccctcaagtccttc
gcgtatggctcgctgctgttgcaggcgcgctacctgctccgcatgtgctccttgccgtcc
ttcacggagcgcaaggcgcagttcgcggaggccctggaggagggcagcctgcgtagcctc
gtcgccagcggtttcggctacgacctcctctgctccatcatgttcgaccgtcagatggag
cacctagtgcacatatgcctcgagctgttcattcgccgtgagtactctggcgagagcgag
atcaaggacctggacattttgaagcagggcaccagctggtacgccagctacagcttcgac
cccatcgaggatgcggaggtgctgcacatgagcgacgagctggctgtggggtcgcgaaga
ataatcggtgggcggggcatctgcgtcatgctgcccgatgagaagctgctccagtcgacg
ctggcctcgtcgttccgcgatgttgtgtcacactacagcgacgacatcgtcatcgcaacc
gtcttcttctccgtctcgcgcgagtcgacgcagtcagacgtggcgcgcatgtgtcgcctg
ctgatggaggagaacgcggccgtctttcagaagttcgaaaagctcgagacggtgtacttc
atggcacatgggatgccggaggggccgcatttcttcacgttccgggcggagacgggcttc
caggaggacacactgctgcgcaacgtgctgccacagtcggcacgtcggctggaactcgac
cggctgtcgaactacgaggtgagcatgcacccgacaccctacaaggatgtacacgtgttc
aaggcggcccccaagaaggctggcgcgtccgcgctggagcaccgcatgttcgcgcgtgtg
gcggtgacgcctcacgacatgggcatgactccctggacggaggtgacggacgtggatgtg
ggccacatgctggctaagtgcctggcagcgctgcaggtagcccgcgacgactcgacggtg
aagtttccggacagcaatcacgtgttcgtaaagatgattgagctgaccttcgacgtacgc
tcgctgcagcccctgctggtggcggcggccagctcgtaccaggagaagctgacggagttg
ggtgtgcgggatgtggaagtatcctttcacgtgaaggtgccgtcgggtctcattccaatg
cgtgtcatcgccaagagcccgtctggctatggcgtgtcggtgcatgtctactacgagtca
ctgtcgaacggccagctgcagctgcaccgtgccgagacgtctgaggacgtcgactactcg
tccacgggccgctccgccgagtccctgctggagatgagcctcacctcccctatgatgccg
gcgccgcgcgggacgccgcatctgatgcgcaccgcgtcgaagctgggggacctgcgcgag
atgctgccgtccgaaaaagagcagcaaatttccgtcgatatgatgtcggagccgacggag
acgcgccaccgcgccatcactctcgggccgtacccacagcttgaagcgcgtgacgtgaag
cgcctgcaggcacgccgcgccggcacgacgtacgtgcacgactggccggccgtgctgaac
cttatcctacgtaaggagtggatgaagctgcgctgcgcgctggatctgcctcacacctcc
atcccaaagaacccgctgcgcgccacggagctctttctttgcgaggacggggaattgctg
tcgacgagaaggaccttcgcgcagtcgtgtggcatggtggtgtggatggtcgagtacgcg
ccgccgcgctacttcgatatggagttgaagacggcgcagacgcgccgcatcgtggtcgtc
gccaatgacatcacctttcagtccggatccttcgccgtcccggaggactgcgtcttcaag
gccgcctcggtgcttgcccgcgcgcagcacgtgccgtttgtgtacattagcaccaacagc
ggcgcacgtcttggcctcagcaccgaggtcaagaagaggttcctcgtcgagttcacggag
aagaatgatatagcctacctgtacctcaccaagagcgactacgaggagctgagggaacgg
aagaagattcagatggaggcggagccgcttgaggtgaaaggcgaaacgcggtacgtgata
aaaggcgtggtgggcgggccgacggagtacatcggcgttgaaaacctgagcgggtccggt
ctcgtggcgggtgagatgtcgaagaactacagcgagatcccgaccatcagcctcgtctcg
gggcgcagtgtcggcatcggcgcttacctgaaccgtcttggccgccgcgtcatccagacg
aacgactcgcctctcatcctgactggcgccggtgctctcaaccgactgctcggcaaggac
gtgtacatgggcaacagccagctcggcggcaagcagattatggtgccgaacggtgtcacg
cactggtgcacacaccacgactatggctctgcccgcgtgctgctgcggtggctcgactac
gtgccggctgtcctgcaccctcggcgctgcacaccgcatcgcctgctctgggcctctgtc
gacccgatcgatcgcgacgtgaccttctgcccgacgtcgaacacgcagtacgacccacgc
ctcctcgtgacgggactgctcggtcagacgggcctgttcgaccgcggctcgtggatggag
acgctggaggggtgggcacgtacggtggtggtcggccgcgccacgctcggcggcatcccc
tgcggcgttatccttgttgagacgcgcctgacgaagaagttcgacccggcagatccggct
gacccgacctcgacgtcttcttttattacgcaggcgggccaggtgtggtttcccgactcg
gcgcgcaagacggccgacgccctcgatgacttccaccatgaacggctgccatgcttcatc
ctggcgaactggcgcggcttctcgggtggcatgcgcgacatgtttgacgaggtgctgaag
tttggcgcctccatcgtcgacaacctccgcgtctacactgcgccggtcttcatctacatt
ccgccagggggcgagctgcgaggtggggcctgggtggtcgtggacccgacgatcaaccac
aacggcgtcgtcgagatgtactgcgacccgtcctcgcgcggtggcatccttgagccgtct
ggtgtggtggagatcaagtttcgcgacgacgacgtgctgcagctgattcggcgcagtcgg
ccggacctcgcagcgatggaggcgaaggcggcccgtgaggccgagaaagagctgctgccg
cattaccgcgacgttgcggtgcgcttcgccgatctgcatgacacgtacgtgcggatgaaa
gcgaccggtgtggtgcgcgacgtcgtcccgtggaaagatagccgccgccacttctaccac
aagctgcaacgcaaactgaaggagctggaggtggcgaacgatatgctcgaggtcggcgtc
gtcgactcccttgcagggggcgttcgcaaggtcgaggagtgctactcggtggcgcacccc
aacggaccggcgtggggcacggccgaccaggatcaactgaagtggctgcagggtctcgat
ggcacctggattggggagagcaacggccacgcggctctgaacaacagcgaatgggcgaag
gaactgcagcgcctgctcaccctgcacggcggtgaggagagctcgatggagcgcgcgctg
gcgaaactcttcgagaacccggcaatcgccaaggccgcgaaggtagccttggactcgtcg
gcctgtgcgcacagcacggctgaatag

DBGET integrated database retrieval system