KEGG   Leishmania infantum: LINJ_32_0550Help
Entry
LINJ_32_0550      CDS       T01112                                 

Definition
putative profilin
Orthology
K05759  
profilin
Organism
lif  Leishmania infantum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
32:191923..192375
Genome map
AA seq 150 aa AA seqDB search
MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYVPQPEEVQHIQKCLSDFSLVQSS
GVNIYGVKFFGLQCGTDGDCKYIFFKKGAAGGCIYTTKQAFIVAVYGNPGDTSSLQQDLE
KNTAHTVTVNPADCNTTVKRIADYLIKLGY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaggcatacgttgatgacagccttatcggcagcggcaacatgcacagcgct
gctattattggagccgctgatggcagctactgggcgtatggcggtagctacgttccgcag
ccggaagaggtgcagcacatccagaagtgcttgtccgacttctcgctcgtgcagtcctct
ggtgtgaatatttacggtgtcaagttcttcggcctccagtgcggcaccgacggcgactgc
aagtacatctttttcaagaaaggtgcagccggcgggtgcatttacacgacgaagcaggca
ttcatcgttgccgtatatgggaaccccggtgacacctcctcgcttcagcaggatcttgag
aagaacacggctcacacggtcaccgtgaaccctgcggactgcaacactacagtgaagcgc
atagcggattacctcattaagcttggctactaa

DBGET integrated database retrieval system